DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and Ube2v2

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:XP_017453380.1 Gene:Ube2v2 / 287927 RGDID:727838 Length:160 Species:Rattus norvegicus


Alignment Length:142 Identity:94/142 - (66%)
Similarity:121/142 - (85%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TSSTGVVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLK 68
            |..|||.|||||||||||::|||||||||:|||||:|:|||||.|.|||||||||.:|||:||||
  Rat    17 TGLTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLK 81

  Fly    69 IECGERYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTMKEN 133
            :|||.:||:.||::||:||:|:|.||.::|:||.||:.:||:|...|:||.:|||:||:|..|||
  Rat    82 VECGSKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKEN 146

  Fly   134 LKLAQPPEGSCF 145
            :||.|||||..:
  Rat   147 MKLPQPPEGQTY 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 83/125 (66%)
Ube2v2XP_017453380.1 UBCc 29..160 CDD:214562 85/130 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352315
Domainoid 1 1.000 142 1.000 Domainoid score I4568
eggNOG 1 0.900 - - E1_KOG0896
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3530
OMA 1 1.010 - - QHG54124
OrthoDB 1 1.010 - - D1507995at2759
OrthoFinder 1 1.000 - - FOG0001338
OrthoInspector 1 1.000 - - otm46082
orthoMCL 1 0.900 - - OOG6_101344
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X939
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.