DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and mms2

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_588162.1 Gene:mms2 / 2538720 PomBaseID:SPCC338.05c Length:139 Species:Schizosaccharomyces pombe


Alignment Length:135 Identity:62/135 - (45%)
Similarity:93/135 - (68%) Gaps:0/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGERY 75
            |||||:|||||::|:||:|:.:.|:||.|.||:||:.|...|:||..:..|||:|||||.|...|
pombe     4 VPRNFKLLEELEKGEKGLGESSCSYGLTNADDITLSDWNATILGPAHSVHENRIYSLKIHCDANY 68

  Fly    76 PDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTMKENLKLAQPP 140
            ||.||.:.|::::|:..::...|.|:...:..|..|.|||:::|:|.::::.|....|.||.|||
pombe    69 PDAPPIVTFVSRINLPGVDGETGKVNPHKIDCLRHWKREYSMETVLLDLKKEMASSSNRKLPQPP 133

  Fly   141 EGSCF 145
            |||.|
pombe   134 EGSTF 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 53/125 (42%)
mms2NP_588162.1 UBCc 9..139 CDD:214562 57/130 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2128
eggNOG 1 0.900 - - E1_KOG0896
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I1359
OMA 1 1.010 - - QHG54124
OrthoFinder 1 1.000 - - FOG0001338
OrthoInspector 1 1.000 - - oto101837
orthoMCL 1 0.900 - - OOG6_101344
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2190
SonicParanoid 1 1.000 - - X939
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.