DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and uev-1

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_493578.1 Gene:uev-1 / 173347 WormBaseID:WBGene00006730 Length:139 Species:Caenorhabditis elegans


Alignment Length:138 Identity:88/138 - (63%)
Similarity:110/138 - (79%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGE 73
            |.|||||||||||::||||.|||.||||||:|.|||||.|...||||||||:|:|:|:|:|:||.
 Worm     2 VDVPRNFRLLEELEEGQKGKGDGNISWGLEDDSDMTLTRWTASIIGPPRTPYESRIYNLQIQCGG 66

  Fly    74 RYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTM-KENLKLA 137
            .||.||||:||.|||::..:||:|||:|.|::..|..||..|.|||:|::||:.|.| ||||||.
 Worm    67 NYPREPPTVRFTTKVHMVGVNQSNGVIDKRNLTTLRNWSNSYMIKTVLEDIRKNMMMAKENLKLQ 131

  Fly   138 QPPEGSCF 145
            ||.||:.|
 Worm   132 QPAEGAMF 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 79/126 (63%)
uev-1NP_493578.1 UBCc 9..139 CDD:214562 81/129 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166018
Domainoid 1 1.000 120 1.000 Domainoid score I3580
eggNOG 1 0.900 - - E1_KOG0896
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H81888
Inparanoid 1 1.050 186 1.000 Inparanoid score I2603
Isobase 1 0.950 - 0 Normalized mean entropy S314
OMA 1 1.010 - - QHG54124
OrthoDB 1 1.010 - - D1507995at2759
OrthoFinder 1 1.000 - - FOG0001338
OrthoInspector 1 1.000 - - oto17386
orthoMCL 1 0.900 - - OOG6_101344
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2190
SonicParanoid 1 1.000 - - X939
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.