DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and ube2v1

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001192035.1 Gene:ube2v1 / 100551497 XenbaseID:XB-GENE-950453 Length:147 Species:Xenopus tropicalis


Alignment Length:145 Identity:96/145 - (66%)
Similarity:124/145 - (85%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANTSSTGVVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMY 65
            ||.|:.:||.|||||||||||::|||||||||:|||||:|:|||||.|.|||||||||.:|||:|
 Frog     1 MAATTVSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIY 65

  Fly    66 SLKIECGERYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTM 130
            |||:|||.:||:.||.:||:||:|:|.:|.:|||||.|::.:||:|...|:||.:|||:||:|..
 Frog    66 SLKVECGPKYPEAPPFIRFVTKINMNGVNNSNGVVDPRTISVLAKWQNSYSIKVILQEMRRLMMS 130

  Fly   131 KENLKLAQPPEGSCF 145
            |||:||.|||||.|:
 Frog   131 KENMKLPQPPEGQCY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 83/125 (66%)
ube2v1NP_001192035.1 UBCc 16..142 CDD:214562 83/125 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4620
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H81888
Inparanoid 1 1.050 220 1.000 Inparanoid score I3459
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507995at2759
OrthoFinder 1 1.000 - - FOG0001338
OrthoInspector 1 1.000 - - otm49166
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2190
SonicParanoid 1 1.000 - - X939
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.