DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c1 and Cyt-c1L

DIOPT Version :9

Sequence 1:NP_001246637.1 Gene:Cyt-c1 / 38612 FlyBaseID:FBgn0035600 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_651683.1 Gene:Cyt-c1L / 43457 FlyBaseID:FBgn0039651 Length:344 Species:Drosophila melanogaster


Alignment Length:297 Identity:197/297 - (66%)
Similarity:230/297 - (77%) Gaps:7/297 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GLRLLKSAPALSLQQAKNLSSAGSWASGNKKLIGALGAITGGVGALIYALEQSVQASGGEVHSPA 74
            |::.....|.:|      ....||..:||:||:|||||:||..|.||||||.||.||...||...
  Fly    19 GIQRTSVRPRIS------FPGRGSGFTGNRKLLGALGALTGTAGLLIYALETSVDASSDCVHPAH 77

  Fly    75 QLWNHKGLFDALDHQSVRRGYEVYKQVCSACHSMQYIAYRNLVGVTHTEAEAKAEAEQITVKDGP 139
            |.||||||..|||.:||||||.|||:|||:|||:||:||||||||..||||||||||.|||:|||
  Fly    78 QHWNHKGLLSALDKESVRRGYTVYKEVCSSCHSLQYMAYRNLVGVCMTEAEAKAEAEAITVRDGP 142

  Fly   140 DDTGNYYTRPGKLSDYFPSPYPNEEAARAANNGAYPPDLSYIVSARKGGEDYIFSLLTGYHDAPA 204
            ::.|.||.|||||||:|||||.||||||:||||:||||||||||||||||||:|||||||.|.||
  Fly   143 NEEGEYYERPGKLSDHFPSPYANEEAARSANNGSYPPDLSYIVSARKGGEDYVFSLLTGYCDPPA 207

  Fly   205 GVVLREGQYFNPYFPGGAISMAQVLYNEVIEYED-GTPPTQSQLAKDVATFLKWTSEPEHDDRKQ 268
            |..||:|.||||||.||||:|.:|:.|||:.:|| ..|.:.:|:||||..|||||||||.|:|:.
  Fly   208 GFALRDGLYFNPYFSGGAIAMGKVVDNEVVSFEDPNVPASAAQIAKDVCVFLKWTSEPETDERRL 272

  Fly   269 LLIKVIGILGFLTVISYYIKRHKWSSLKSRKIVFVPK 305
            |||||..|..||..|||||||.|||:||||||.|:|:
  Fly   273 LLIKVTLISTFLIGISYYIKRFKWSTLKSRKIFFIPE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c1NP_001246637.1 CYT1 69..296 CDD:225413 162/227 (71%)
Cytochrom_C1 77..295 CDD:280350 159/218 (73%)
Cyt-c1LNP_651683.1 CYT1 73..300 CDD:225413 162/226 (72%)
Cytochrom_C1 80..299 CDD:280350 159/218 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460706
Domainoid 1 1.000 272 1.000 Domainoid score I433
eggNOG 1 0.900 - - E1_COG2857
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 290 1.000 Inparanoid score I832
Isobase 1 0.950 - 0 Normalized mean entropy S421
OMA 1 1.010 - - QHG54185
OrthoDB 1 1.010 - - D439021at33208
OrthoFinder 1 1.000 - - FOG0003553
OrthoInspector 1 1.000 - - otm24321
orthoMCL 1 0.900 - - OOG6_102032
Panther 1 1.100 - - P PTHR10266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2430
1312.760

Return to query results.
Submit another query.