DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c1 and cyc1

DIOPT Version :9

Sequence 1:NP_001246637.1 Gene:Cyt-c1 / 38612 FlyBaseID:FBgn0035600 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_989234.1 Gene:cyc1 / 394843 XenbaseID:XB-GENE-6455900 Length:309 Species:Xenopus tropicalis


Alignment Length:307 Identity:182/307 - (59%)
Similarity:227/307 - (73%) Gaps:3/307 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAA---TLRRFHGLRLLKSAPALSLQQAKNLSSAGSWASGNKKLIGALGAITGGVGALIYALEQS 62
            |||   .|||..|..:|:...|......:...|..:.:.|.|..:..||.:..|...|.:||.||
 Frog     1 MAAACLVLRRSLGGAVLQGGRAAWPVAPQANMSFSTLSRGRKVALSTLGILVAGGSGLAFALHQS 65

  Fly    63 VQASGGEVHSPAQLWNHKGLFDALDHQSVRRGYEVYKQVCSACHSMQYIAYRNLVGVTHTEAEAK 127
            |:||..|:|.|:..|:|.||..:|||.|:||||:||||||:|||||:|:|:|||:||:|||||||
 Frog    66 VKASELELHPPSYPWSHNGLLSSLDHASIRRGYQVYKQVCAACHSMEYLAFRNLIGVSHTEAEAK 130

  Fly   128 AEAEQITVKDGPDDTGNYYTRPGKLSDYFPSPYPNEEAARAANNGAYPPDLSYIVSARKGGEDYI 192
            |.||:..:.||||:.|..:|||||||||||.||||:|||||:||||.||||||||:||.|||||:
 Frog   131 ALAEEFEILDGPDENGEMFTRPGKLSDYFPKPYPNDEAARASNNGALPPDLSYIVNARHGGEDYV 195

  Fly   193 FSLLTGYHDAPAGVVLREGQYFNPYFPGGAISMAQVLYNEVIEYEDGTPPTQSQLAKDVATFLKW 257
            |||||||.|.||||.||||.|:||||||.|:.||..:||||:|::||||.|.||:||||.|||:|
 Frog   196 FSLLTGYCDPPAGVSLREGLYYNPYFPGQAVGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRW 260

  Fly   258 TSEPEHDDRKQLLIKVIGILGFLTVISYYIKRHKWSSLKSRKIVFVP 304
            .||||||.||::.:||:.|...|..:.||:|||:||.||||||.:.|
 Frog   261 ASEPEHDQRKRMGLKVLMISSILIPLIYYMKRHRWSVLKSRKIAYRP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c1NP_001246637.1 CYT1 69..296 CDD:225413 152/226 (67%)
Cytochrom_C1 77..295 CDD:280350 149/217 (69%)
cyc1NP_989234.1 Cytochrom_C1 80..296 CDD:366950 147/215 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 335 1.000 Domainoid score I1137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55617
Inparanoid 1 1.050 376 1.000 Inparanoid score I2045
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D439021at33208
OrthoFinder 1 1.000 - - FOG0003553
OrthoInspector 1 1.000 - - otm49053
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2430
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.