DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp64D and KIF7

DIOPT Version :10

Sequence 1:NP_523934.1 Gene:Klp64D / 38611 FlyBaseID:FBgn0004380 Length:677 Species:Drosophila melanogaster
Sequence 2:XP_011519833.1 Gene:KIF7 / 374654 HGNCID:30497 Length:1384 Species:Homo sapiens


Alignment Length:48 Identity:16/48 - (33%)
Similarity:24/48 - (50%) Gaps:6/48 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SEETKWVPVTKLGRLVADN-KITKLEQIYLHSLPVKEYQIIDHLVGPT 94
            ||.|..|..|:....|||: ...:.:::||...|||.:     |.||:
Human   337 SELTAAVEPTEEATPVADDPNERESDRVYLDLTPVKSF-----LHGPS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp64DNP_523934.1 KISc_KIF3 19..352 CDD:276822 16/48 (33%)
Smc <433..>578 CDD:440809
KIF7XP_011519833.1 KISc_KIF4 56..391 CDD:276823 16/48 (33%)
Smc <743..>1239 CDD:440809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.