DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp64D and Ggamma1

DIOPT Version :9

Sequence 1:NP_523934.1 Gene:Klp64D / 38611 FlyBaseID:FBgn0004380 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster


Alignment Length:41 Identity:13/41 - (31%)
Similarity:20/41 - (48%) Gaps:10/41 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 MRKHISAHKTSGKEPDFLDLSHVYLSYNTDGVSNPMRSKSA 661
            |.|:|:.|    ::.|:|      |:..|....||.|.||:
  Fly    36 MMKYITEH----EQEDYL------LTGFTSQKVNPFREKSS 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp64DNP_523934.1 KISc_KIF3 19..352 CDD:276822
Kinesin 26..352 CDD:278646
RILP-like <437..556 CDD:304877
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.