DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp64D and CG14535

DIOPT Version :9

Sequence 1:NP_523934.1 Gene:Klp64D / 38611 FlyBaseID:FBgn0004380 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_001285726.1 Gene:CG14535 / 34073 FlyBaseID:FBgn0031955 Length:1131 Species:Drosophila melanogaster


Alignment Length:504 Identity:123/504 - (24%)
Similarity:197/504 - (39%) Gaps:120/504 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IENVRVVVRTRPMDKNELSAGA-LSAISVDKINRAITVMKPNATANEP------------PKTYY 69
            :..|:|::|....|:|  |.|. ...:::||..|.:|:..|......|            ||.:.
  Fly    42 VGKVKVMLRVADRDRN--SGGTEPDFMALDKKKRQVTLTDPRTACPPPQAAQERAPMVAAPKMFA 104

  Fly    70 FDNVFDGGSNQMDLYVDTARPIVDKVLEGYNGTILAYGQTGTGKTYT----MSGNPDSPQTK--- 127
            |||:|.|...|.|:.......::..||||.:|.:||.|...||:..|    :.|...|....   
  Fly   105 FDNLFTGEDKQSDVCASALSEVIPAVLEGSDGCLLAMGYPATGQAQTVLGELGGGSGSGSASGSG 169

  Fly   128 -----GIIPNAFAHIFGHI--AKAKENQKFLVRVSYMEIYNEEVRDLLGKD--VGKSLEVKERPD 183
                 |..|.|.|.::..|  .:.|...:|.||||.:.: :....|.|.:|  :..:.|..:.| 
  Fly   170 VACSLGAAPCAIAWLYKGIQERRQKSGARFSVRVSAVGV-SATKPDALSQDLLISHAAESDDSP- 232

  Fly   184 IGVFVKD--LSGYVVHNADDLENI-----MRLGNKNRAVGATKMNQESS----RSHAIFSITVER 237
             |::::|  |.|.....|...|..     ..|..:.::.|:|.......    .|..||::.|.:
  Fly   233 -GIYLRDDFLGGPTELRAPTAERAALFLDSALAGRLKSSGSTASGSSGCAAPLESALIFTLHVYQ 296

  Fly   238 SELG-EGDVQHVRMGKLQLVDLAGSERQSKTQASGQRLKEATKINLSLSVLGNVISALVDGKSTH 301
            ..|. :|.|...| .:|.::||.|...::.              .|.||.:||::.|::.|: .|
  Fly   297 YSLSRKGGVAGGR-SRLHIIDLGGCANRNG--------------GLPLSGIGNILLAILSGQ-RH 345

  Fly   302 IPYRNSKLTRLLQDSLGGNSKTVMC-----ATISPADSNYMETISTLRYASRAKNIQNRMHINEE 361
            .|:::..||.||:|.|.    .:.|     |.:.| :.:|.:.:||::.|||...::.|.|....
  Fly   346 PPHKDHPLTPLLKDCLA----PITCHVAIVAHVRP-EQSYQDALSTIQIASRIHRLRRRKHRVPM 405

  Fly   362 PKDALLRHFQEEIARLRKQLEEG-------DSLEEEPPSSEEEEDTA------DD--ELEAPLEI 411
            |              |...|.:|       .....:|.|||...||.      ||  :.|.| .:
  Fly   406 P--------------LAVGLAQGLGGNGSSAGSGADPSSSEISADTVIYMGPNDDATDGEHP-PV 455

  Fly   412 ELESSTI-------------QAVEKKPKKKREKT-----DAEKEELAKR 442
            .|.|.|.             ..:||.|.|....:     .|...|.||:
  Fly   456 YLPSLTAGDNRGVMSKALKGSGLEKPPSKSASNSPMMMKKAMAAEKAKK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp64DNP_523934.1 KISc_KIF3 19..352 CDD:276822 96/378 (25%)
Kinesin 26..352 CDD:278646 94/371 (25%)
RILP-like <437..556 CDD:304877 3/6 (50%)
CG14535NP_001285726.1 Motor_domain 44..394 CDD:277568 96/375 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.