DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp64D and Kif26a

DIOPT Version :9

Sequence 1:NP_523934.1 Gene:Klp64D / 38611 FlyBaseID:FBgn0004380 Length:677 Species:Drosophila melanogaster
Sequence 2:XP_006240697.1 Gene:Kif26a / 314473 RGDID:1307957 Length:1881 Species:Rattus norvegicus


Alignment Length:509 Identity:136/509 - (26%)
Similarity:233/509 - (45%) Gaps:87/509 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VRVVVRTRPMDKNELSAGALSAISVDKINRAITVMKP-----------NATANEPPKTYYFDNVF 74
            |:|::|..|....:.||.:.|.:.||...:.:|:..|           :|.....||.:.||.:|
  Rat   365 VKVMLRIWPAQGVQRSAESTSFLKVDSRKKQVTLYDPAAGPPGCAGLRHAPTAPVPKMFAFDAIF 429

  Fly    75 DGGSNQMDLYVDTARPIVDKVLEGYNGTILAYGQTGTGKTYTMSGNPDSPQTKGIIPNAFAHIFG 139
            ...|.|.::...|...::..|:.|.:|.|.::|....||:|||.|...|||:.||:|.|.:.:|.
  Rat   430 PQDSEQAEVCSGTVADVLQSVVGGADGCIFSFGHMSLGKSYTMIGKDSSPQSLGIVPCAISWLFR 494

  Fly   140 HIAKAKE--NQKFLVRVSYMEI--YNEEVRDLLGKDVGKSLEVKERPDIGVFVKD--LSGYVVHN 198
            .|.:.||  ..:|.:|||.:|:  :::.:||||.:.....|:..:.|  ||::::  :.|..:.|
  Rat   495 LIDERKERLGTRFSIRVSAVEVCGHDQSLRDLLAEVASGCLQDTQSP--GVYLREDPVCGTQLRN 557

  Fly   199 ADDLENIMRLGNKNRA---VGATKMNQESSR----------SHAIFSITVER---SELGEGDVQH 247
                :|.:|.....:|   :.|....:.:||          ||.:|::.|.:   .:.|:|.:..
  Rat   558 ----QNELRAPTAEKAAFYLDAALAARSTSRAGCGEDARRTSHMLFTLHVYQYRVEKCGQGGMSG 618

  Fly   248 VRMGKLQLVDLAGSERQSKTQASGQRLKEAT--KINLSLSVLGNVISALVDGKSTHIPYRNSKLT 310
            .| .:|.|:||...|      |:..|..||:  .:.||||.||:||.|||:| :.|:|||:..||
  Rat   619 GR-SRLHLIDLGSCE------AAPSRGGEASGGPLCLSLSALGSVILALVNG-AKHVPYRDHTLT 675

  Fly   311 RLLQDSLGGNS-KTVMCATISPADSNYMETISTLRYASRAKNIQNRMHINEEPKDALLRHFQEEI 374
            .||::||...| .|.|.|.||.:.:::.||:||::.|:|...::.:...:...........:|..
  Rat   676 MLLRESLATTSCCTTMIAHISDSPTHHAETLSTVQLAARIHRLRRKKGKHASSSSGGESSCEEGR 740

  Fly   375 ARLRKQL-------------EEGDSLEEEPPSSEEEEDTADDEL-EAPLEIELESSTIQAVEKKP 425
            ||....|             ....:|..:|..|...|.:.|..: ..|....|..          
  Rat   741 ARRPPHLRPFHPRTVVLDPDRSAPALSGDPDYSSSSEQSCDTVIYVGPGGTALSD---------- 795

  Fly   426 KKKREKTDAEK--------EELAKRK-NEHQKEIEHAKTEQ-ETLRNKLVSLEG 469
               ||.||.|.        ..|::|: :|..::.:|.:... ..|:.:|..::|
  Rat   796 ---RELTDNEGPPDFVPIIPALSRRRPSEGPRDADHFRCSTFAELQERLECIDG 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp64DNP_523934.1 KISc_KIF3 19..352 CDD:276822 113/366 (31%)
Kinesin 26..352 CDD:278646 111/361 (31%)
RILP-like <437..556 CDD:304877 7/35 (20%)
Kif26aXP_006240697.1 KISc 364..716 CDD:276812 113/364 (31%)
KISc 365..725 CDD:214526 113/373 (30%)
PRK07764 <837..1309 CDD:236090 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.