DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp64D and CG32318

DIOPT Version :9

Sequence 1:NP_523934.1 Gene:Klp64D / 38611 FlyBaseID:FBgn0004380 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster


Alignment Length:109 Identity:33/109 - (30%)
Similarity:54/109 - (49%) Gaps:14/109 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PQEEANAGTTAQLDDEIENVRVVVRTRPMDKNELSAGALSAISVDKINRAITVMKPNATANEPPK 66
            ||:::|           :|::|.||.||::..|....:...:.|......:|   .:...::..|
  Fly    12 PQKKSN-----------QNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVT---RHTLDSKLTK 62

  Fly    67 TYYFDNVFDGGSNQMDLYVDTARPIVDKVLEGYNGTILAYGQTG 110
            .:.||..|...|.|.|:|.....|::::||.|||.|:.||||||
  Fly    63 KFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTG 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp64DNP_523934.1 KISc_KIF3 19..352 CDD:276822 30/92 (33%)
Kinesin 26..352 CDD:278646 27/85 (32%)
RILP-like <437..556 CDD:304877
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 29/102 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437770
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.