DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT14 and Ppi1

DIOPT Version :10

Sequence 1:NP_000517.3 Gene:KRT14 / 3861 HGNCID:6416 Length:472 Species:Homo sapiens
Sequence 2:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster


Alignment Length:97 Identity:22/97 - (22%)
Similarity:47/97 - (48%) Gaps:7/97 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   240 ESLKEELAYLKKN-HEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYE-KMAEKNRK-- 300
            |::.::...|::: .|....|.:.........|..|.| .||:::..|:||.:. |.|::|:|  
  Fly   458 EAIVKDYQLLRRSIRESNTKATQSATKNPTAQEGSAQP-QDLAKVFTELRDLFNVKAADENQKIQ 521

Human   301 --DAEEWFFTKTEELNREVATNSELVQSGKSE 330
              .||.....|:.:.::....:.|..::||::
  Fly   522 DICAEACALAKSHKKSKNRPASPERTKAGKTD 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT14NP_000517.3 Head 1..114
Filament 114..425 CDD:459643 22/97 (23%)
Coil 1A 115..150
Linker 1 151..168
Coil 1B 169..260 3/20 (15%)
Linker 12 261..283 5/21 (24%)
Coil 2 284..422 13/52 (25%)
Tail 423..472
Interaction with Type I keratins and keratin filaments 425..472
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..472
Ppi1NP_733345.2 DUF4788 108..>294 CDD:406440
DUF4776 371..848 CDD:406413 22/97 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.