DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT14 and CG3199

DIOPT Version :10

Sequence 1:NP_000517.3 Gene:KRT14 / 3861 HGNCID:6416 Length:472 Species:Homo sapiens
Sequence 2:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster


Alignment Length:114 Identity:23/114 - (20%)
Similarity:42/114 - (36%) Gaps:29/114 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   316 EVATNSELVQSGKSEISELRRTMQNLEIELQS-----QLSMKASLENSLE------------ETK 363
            ||..:.::|..||..:.:...|...|:::..|     .|.|:.....:||            ..:
  Fly   112 EVVYDEQVVGLGKLSLPKRLSTRIKLDMKAFSYTSTCPLEMEGKPVGALEFLCKLFIKCGDYARE 176

Human   364 GRYCMQL---AQIQEMIGSVEEQLAQLRC--------EMEQQNQ-EYKI 400
            |..|..|   ...::::..|.:..|...|        |:|.:.| :|.|
  Fly   177 GETCPNLDRNLSPRDIVFVVGKSQANTSCCDPCRDALEIEARKQKDYSI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT14NP_000517.3 Head 1..114
Filament 114..425 CDD:459643 23/114 (20%)
Coil 1A 115..150
Linker 1 151..168
Coil 1B 169..260
Linker 12 261..283
Coil 2 284..422 23/114 (20%)
Tail 423..472
Interaction with Type I keratins and keratin filaments 425..472
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..472
CG3199NP_650342.2 DUF4788 45..>216 CDD:406440 19/103 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.