DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT14 and Osi4

DIOPT Version :10

Sequence 1:NP_000517.3 Gene:KRT14 / 3861 HGNCID:6416 Length:472 Species:Homo sapiens
Sequence 2:NP_001262305.1 Gene:Osi4 / 40758 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster


Alignment Length:127 Identity:38/127 - (29%)
Similarity:47/127 - (37%) Gaps:44/127 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    12 SSMKGSCGIGGGIGG-------GSSRI---------------SSVLAGGSCRAPSTYGGGLSVSS 54
            :|.|...|.|.|:.|       .:.|:               |..:.....:..|:..|.|.|  
  Fly   100 ASRKHKWGTGRGLSGFMDFVTENAIRVPVGPMVFSVQRAEDDSDYIEVALLKKTSSSTGRLQV-- 162

Human    55 SRFSSGGACGLGGGYGGGFSSSSSSFGSGFGGGYGGGLGAGLGGGFGGGFAGGDGLLVGSEK 116
               :.||..|.|||.||             .||.||||   |||| ||...||.|||.|..:
  Fly   163 ---NGGGLLGGGGGLGG-------------NGGGGGGL---LGGG-GGDNGGGGGLLGGRRR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT14NP_000517.3 Head 1..114 37/123 (30%)
Filament 114..425 CDD:459643 0/3 (0%)
Coil 1A 115..150 0/2 (0%)
Linker 1 151..168
Coil 1B 169..260
Linker 12 261..283
Coil 2 284..422
Tail 423..472
Interaction with Type I keratins and keratin filaments 425..472
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..472
Osi4NP_001262305.1 DUF1676 <203..261 CDD:462310 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.