DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT14 and CG31533

DIOPT Version :10

Sequence 1:NP_000517.3 Gene:KRT14 / 3861 HGNCID:6416 Length:472 Species:Homo sapiens
Sequence 2:NP_731887.1 Gene:CG31533 / 318788 FlyBaseID:FBgn0051533 Length:844 Species:Drosophila melanogaster


Alignment Length:273 Identity:57/273 - (20%)
Similarity:102/273 - (37%) Gaps:72/273 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   176 ILTATVDNANVLL----------QIDNARLAADDFRTKYETEL-----NLRMSVEADINGLRRVL 225
            |...|:|....||          ::.::|:..|.|....|.||     .||.|:|.....|..|.
  Fly    18 IFGVTIDEPAKLLVETKVAGKSVKVTSSRINVDQFVAGREFELPMEASTLRQSLEEKGLTLAGVY 82

Human   226 DELTLARADLEMQIESLKEELAYLKKN--HEEEMNALRG-QVGGDVNVEMDAAPGVDLSRILNEM 287
            ...||.:|.....:|.| ::::....:  ||:.::.:|. .|.|.|:|         |.|:..:.
  Fly    83 QGSTLGKATGNFPVEFL-DKISPTMNDLVHEDTLDLVRRVDVVGTVSV---------LIRLTVKC 137

Human   288 RDQYEKMAEK---NRKDAEEWFFTKTEELNREVATNSE------------------LVQSGKSEI 331
            .:..|:...:   :|.........|.|:..| |:..|:                  |::......
  Fly   138 EEHPEQKPSRQSLSRTSKSSMILPKKEKSGR-VSCASQGPTFNPQDVMFLIGDPDPLLRIPSEPC 201

Human   332 SELRRTM--QNLEIELQSQLSMKASLENSLEETKGRY-----C-------MQLAQIQEMIGSVEE 382
            |||...:  :.|:::||..        .|||..:..:     |       |||.::.|...::.:
  Fly   202 SELLSEIGDERLKLDLQRY--------KSLENRRAIFPDDDRCPKQKPSFMQLKKLTEEYSNIID 258

Human   383 QLAQLRCEMEQQN 395
            .:.:...|||.|:
  Fly   259 SVTKKVKEMEPQS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT14NP_000517.3 Head 1..114
Filament 114..425 CDD:459643 57/273 (21%)
Coil 1A 115..150
Linker 1 151..168
Coil 1B 169..260 24/100 (24%)
Linker 12 261..283 6/22 (27%)
Coil 2 284..422 26/147 (18%)
Tail 423..472
Interaction with Type I keratins and keratin filaments 425..472
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..472
CG31533NP_731887.1 DUF4788 12..260 CDD:406440 53/260 (20%)
DUF4776 315..758 CDD:406413
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.