DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT14 and CG31029

DIOPT Version :10

Sequence 1:NP_000517.3 Gene:KRT14 / 3861 HGNCID:6416 Length:472 Species:Homo sapiens
Sequence 2:NP_733347.1 Gene:CG31029 / 318562 FlyBaseID:FBgn0051029 Length:905 Species:Drosophila melanogaster


Alignment Length:397 Identity:71/397 - (17%)
Similarity:121/397 - (30%) Gaps:134/397 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   101 GGGFAGGDGLLVG------------SEKVTMQNLNDRLASYLDKVRALEEANADLEVKIRDWYQR 153
            ||.||.....|.|            .||..::.|.|.|.  ||:::.  .:..|...|.|.|:.:
  Fly   215 GGAFARCGCFLKGMQLPPDVGTEKKREKAALKKLVDELG--LDEIKV--PSPPDTHEKSRRWHCK 275

Human   154 -QRPAEIKDYS------------------------------------------------------ 163
             ::|:...|.|                                                      
  Fly   276 CKQPSSSTDTSSCDTNEFTAEKPPRKRKAISLTASMERAARRRLMGTCPVKEPVLTQEAYKPPNL 340

Human   164 -----------------PY--FKTIEDLRNK----ILTATVDNANVLL---------QIDNARLA 196
                             ||  :||.||::..    .||||   |..||         ::|.::..
  Fly   341 CQLCRSDISWLPKISACPYCGYKTFEDIQPSEQPYDLTAT---AQQLLRDCLRKETCELDPSKGD 402

Human   197 ADDFRTKYETELNLRMSVEADING-------LRRVLDELTLARADLEMQIESLKEELAYLKKNHE 254
            .:....|.:.:.|:...... :.|       :|::.|...   .:.|.:||.|.:.........:
  Fly   403 DEAMGDKNKDDPNVPQQCGC-LGGKPCTRCRIRKLCDNFF---KENECKIEPLPQAYPQAPSKSQ 463

Human   255 EEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVAT 319
            .|...: .|...|.::..     ..|..|..|||:.:.|....|..|      ...|||.:|...
  Fly   464 PESKKV-NQANSDESLRR-----TQLISIFTEMRNMFGKKKGANEAD------VVAEELRKECDA 516

Human   320 NSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEET--KGRYCMQLAQIQEMIGSVEE 382
            .....:|.|:. .:.|:.:|....|:.......|.:....|.|  |...|....:::.:  |.:.
  Fly   517 ACRNTKSAKAR-RKARKALQKTLDEIDKAYPKPAKMRIKKERTHHKKSRCYTFLKLKTV--SKDS 578

Human   383 QLAQLRC 389
            ::..|.|
  Fly   579 RIGHLDC 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT14NP_000517.3 Head 1..114 6/24 (25%)
Filament 114..425 CDD:459643 65/372 (17%)
Coil 1A 115..150 10/34 (29%)
Linker 1 151..168 5/90 (6%)
Coil 1B 169..260 20/110 (18%)
Linker 12 261..283 3/21 (14%)
Coil 2 284..422 23/108 (21%)
Tail 423..472
Interaction with Type I keratins and keratin filaments 425..472
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..472
CG31029NP_733347.1 DUF4788 33..228 CDD:406440 5/12 (42%)
DUF4776 335..841 CDD:406413 51/273 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.