DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT14 and F10C1.8

DIOPT Version :10

Sequence 1:NP_000517.3 Gene:KRT14 / 3861 HGNCID:6416 Length:472 Species:Homo sapiens
Sequence 2:NP_495132.2 Gene:F10C1.8 / 266725 WormBaseID:WBGene00017327 Length:160 Species:Caenorhabditis elegans


Alignment Length:85 Identity:19/85 - (22%)
Similarity:36/85 - (42%) Gaps:13/85 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   192 NARLAADDFRTKYETELNLRMSVEADING--LRRVLDELTLARADLEMQIESLKEELAYLKKNHE 254
            |..:...|.:.||....|...||..|::.  :|||:|       .::..:..|...|...:..|.
 Worm    42 NVSIVECDPQGKYIILENTSGSVAEDVSNFEIRRVID-------GVQAFVFRLPSHLVIQQHGHL 99

Human   255 EEMNALRGQVGGDVNVEMDA 274
            :    :.|:..|::|:..|:
 Worm   100 K----IYGRNAGEINLTPDS 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT14NP_000517.3 Head 1..114
Filament 114..425 CDD:459643 19/85 (22%)
Coil 1A 115..150
Linker 1 151..168
Coil 1B 169..260 15/69 (22%)
Linker 12 261..283 4/14 (29%)
Coil 2 284..422
Tail 423..472
Interaction with Type I keratins and keratin filaments 425..472
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..472
F10C1.8NP_495132.2 LTD 38..145 CDD:460003 19/85 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.