DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4669 and CG32462

DIOPT Version :9

Sequence 1:NP_647956.2 Gene:CG4669 / 38608 FlyBaseID:FBgn0035598 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_730750.1 Gene:CG32462 / 318043 FlyBaseID:FBgn0052462 Length:284 Species:Drosophila melanogaster


Alignment Length:217 Identity:44/217 - (20%)
Similarity:65/217 - (29%) Gaps:82/217 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 WKEKGVWMVLDLNGRDKNTMKPNNEE-----------GYPLLLGLKSFDNVVWLIKK------ES 271
            ||...:|.:.             :||           |...||..:| :::.||...      ..
  Fly     7 WKMWKLWKIC-------------SEECASTGGILRRLGQTALLSARS-ESMTWLTPSNCLPIWSQ 57

  Fly   272 YLDKNAKFSIREILVVRLATPGSTGQSWEREHGM--RMSQFDVIASDYAYVKSNLHLTLNSKDAL 334
            .|.:|...:..:...|.|     ||:.|....|:  |...||        .|...|.||..    
  Fly    58 RLGRNCVAARSQNFDVEL-----TGRLWSLSGGLHPRAPWFD--------RKVRGHQTLGC---- 105

  Fly   335 RNRSALPVAVATALASKIDHPATWDQKMYDKVMCYGVNMCKNCWEPCMDPSKPMDL----DDFPR 395
                   ..||..:||...|...|..|:.|.::..|    ...:...::.|:..||    ||   
  Fly   106 -------CVVACCVASTFRHLGEWSGKLLDAIVVNG----NRYFRASVEQSERWDLHSGVDD--- 156

  Fly   396 QIRLGQFVAEIMLTPNAYEGWW 417
                    |...|:      ||
  Fly   157 --------ARCNLS------WW 164



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28NDP
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010003
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.