DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shep and AT2G47310

DIOPT Version :9

Sequence 1:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_850472.1 Gene:AT2G47310 / 819344 AraportID:AT2G47310 Length:512 Species:Arabidopsis thaliana


Alignment Length:320 Identity:74/320 - (23%)
Similarity:118/320 - (36%) Gaps:70/320 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 APLPQPAY-AAYT--PHTATTPATTTVSFLSQPVDYYWYGQRVPTAASPSNTNSSSSSNTGSQSG 207
            ||.|.|.| ..|.  ||....|.......:: .|.::.|         |.|.|.....|....||
plant    12 APPPVPYYHNNYNNPPHHQIHPPPPPHHHIA-AVGFHKY---------PQNDNRDQRFNQPHYSG 66

  Fly   208 TLSTSLSNTTNTNTNMGPNGTVQNQNQQGGEQLSK--------------TNLYIRGLQQGTTDKD 258
            .....:.:.:|......|      .:..||..|.|              ..||:..:.:..|:.|
plant    67 QQQNMIVDQSNNAPPPFP------PSPCGGSSLRKRRSQSATDNADGSIAKLYVAPISKTATEYD 125

  Fly   259 LVNMCAQYGTIISTKAIL--DKTTNKCKGYGFVDFEQPAFAECAVKGLQGK--------GVQAQM 313
            :..:..:||.:  |:.||  ||.|.:...|.|:.:::......|:..|..:        .|:.:.
plant   126 IRQVFEKYGNV--TEIILPKDKMTGERAAYCFIKYKKVEEGNAAIAALTEQFTFPGEMLPVKVRF 188

  Fly   314 AKQQEQ----------DPTNLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQMNSKGVGFAR 368
            |:.:.:          |...||:..|.....:.::..:.|:||.:....:..|.....:|..|.:
plant   189 AEAERERIGFAPVQLPDNPKLYVRCLNKQTTKMEVNEVFSRYGIIEDIYMALDDMKICRGYAFVQ 253

  Fly   369 MESREKCEQIIQMFNG-NTIPGAKDPLLVKFADGGPKKKNL------FKTP------DPN 415
            ...:|.....|:..|| .||.|:..||:|:|||  |||..|      |.||      |||
plant   254 FSCKEMALAAIKALNGLFTIRGSDQPLIVRFAD--PKKPRLGEQRSTFNTPPAMQHFDPN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 17/79 (22%)
RRM2_MSSP 322..400 CDD:240690 20/78 (26%)
AT2G47310NP_850472.1 RRM_SF 111..190 CDD:418427 17/80 (21%)
RRM_SF 208..287 CDD:418427 22/80 (28%)
WW 406..432 CDD:395320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.