DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shep and PAB7

DIOPT Version :9

Sequence 1:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_181204.1 Gene:PAB7 / 818238 AraportID:AT2G36660 Length:609 Species:Arabidopsis thaliana


Alignment Length:355 Identity:84/355 - (23%)
Similarity:139/355 - (39%) Gaps:71/355 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 TNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQG- 306
            ||||::.|....::..|....|::|.|:|. ||.......|:||.||:|:.|..|..|.:.:.| 
plant   201 TNLYMKNLDADVSEDLLREKFAEFGKIVSL-AIAKDENRLCRGYAFVNFDNPEDARRAAETVNGT 264

  Fly   307 --------------KGVQAQMAKQQEQDP----------TNLYIANLPPHFKETDLEAMLSKYGQ 347
                          |..:.|:.::|.::.          :|:|:.|:.....|.:|....|:.|.
plant   265 KFGSKCLYVGRAQKKAEREQLLREQFKEKHEEQKMIAKVSNIYVKNVNVAVTEEELRKHFSQCGT 329

  Fly   348 VVSTRILRDQQMNSKGVGFARMESREKCEQIIQMFNGNTIPGAKDPLLVKFADGGPKKKNLFKTP 412
            :.||:::.|::..|||.||....:.|:....::.|:|....|  .||.|..|.....:|...:..
plant   330 ITSTKLMCDEKGKSKGFGFVCFSTPEEAIDAVKTFHGQMFHG--KPLYVAIAQKKEDRKMQLQVQ 392

  Fly   413 DPN-ARAWRDVSAEGI-PVAYDPTMQQNGVSVNVGTPIGVPYSRF-----SAPQVG-GYPVAGSQ 469
            ..| ..|.:..|:..: |..|.|....|       |..|:.|..:     ||..:| .||.:.:.
plant   393 FGNRVEARKSSSSASVNPGTYAPLYYTN-------THPGMVYQSYPLMWKSANMIGSSYPNSEAV 450

  Fly   470 WIPGYM-----------MTQVD-DQTSYSPQYMQMAAAPPLGVTSYK----------PEAVNQVQ 512
            ..|..:           :.::| :..||.|...|.....||.....|          .|....:|
plant   451 TYPPMVANAPSKNRQNRIGKLDRNAVSYVPNVYQSTQMLPLSRDFSKQQHSRTYGRGKEMKKSIQ 515

  Fly   513 PR-----GISMMVSGDTGVP-YGTMMPQLA 536
            .|     |:.|.:.|:...| ...:.||||
plant   516 QRQSETVGMEMQLLGELLHPLVEKLEPQLA 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 23/84 (27%)
RRM2_MSSP 322..400 CDD:240690 22/77 (29%)
PAB7NP_181204.1 PABP-1234 24..582 CDD:130689 84/355 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.