DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shep and elavl1

DIOPT Version :9

Sequence 1:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001005461.1 Gene:elavl1 / 448062 XenbaseID:XB-GENE-481800 Length:326 Species:Xenopus tropicalis


Alignment Length:191 Identity:62/191 - (32%)
Similarity:100/191 - (52%) Gaps:8/191 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 NGTVQNQNQQGGEQLSKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVD 290
            ||...:.:....:.:.:|||.:..|.|..|..:|.::.:..|.:.|.|.|.||......|||||:
 Frog     3 NGYGDHMDDVCRDDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVN 67

  Fly   291 FEQPAFAECAVKGLQGKGVQAQMAKQQEQDPT-------NLYIANLPPHFKETDLEAMLSKYGQV 348
            :.....||.|:..|.|..:|::..|.....|:       ||||:.||....:.|:|.|...:|::
 Frog    68 YLNAKDAERAINTLNGLRLQSKTIKVSVARPSSESIKDANLYISGLPRTMTQKDVEDMFLPFGRI 132

  Fly   349 VSTRILRDQQMN-SKGVGFARMESREKCEQIIQMFNGNTIPGAKDPLLVKFADGGPKKKNL 408
            :::|:|.||... |:||.|.|.:.|.:.|:.|..|||:..||:.:|:.||||....:.||:
 Frog   133 INSRVLVDQATGLSRGVAFIRFDKRSEAEEAIASFNGHKPPGSSEPITVKFAANPNQNKNM 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 24/69 (35%)
RRM2_MSSP 322..400 CDD:240690 31/85 (36%)
elavl1NP_001005461.1 RRM 19..326 CDD:330708 60/175 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614259at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.