DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shep and mod

DIOPT Version :9

Sequence 1:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster


Alignment Length:184 Identity:36/184 - (19%)
Similarity:72/184 - (39%) Gaps:33/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 SNTTNTNTNMG---------PNGTVQNQNQQGGEQLSKTNLYIRGLQQGTTDKDLVNMCAQYGTI 269
            :|:..:..|.|         |.||.:||           .:::..|......||||.:.|::|.:
  Fly   148 ANSEKSEENRGIPKVKVGKIPLGTPKNQ-----------IVFVTNLPNEYLHKDLVALFAKFGRL 201

  Fly   270 ISTKAILDKTTNKCKGYGFVDFEQPAFAECAV----KGLQ-GKGV--QAQMAKQQEQDPTNLYIA 327
            .:.:...:...||..   .:.|:....||..:    |.|. |..|  .:|...::|.:...:.:.
  Fly   202 SALQRFTNLNGNKSV---LIAFDTSTGAEAVLQAKPKALTLGDNVLSVSQPRNKEENNERTVVVG 263

  Fly   328 NLPPHFKETDLEAMLSKYGQVVSTRILRDQQMNSKGVGFARMESREKCEQIIQM 381
            .:.|:..:.||:....|...|.:..|..::.|..   .|.|:.|.:...:.:::
  Fly   264 LIGPNITKDDLKTFFEKVAPVEAVTISSNRLMPR---AFVRLASVDDIPKALKL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 16/76 (21%)
RRM2_MSSP 322..400 CDD:240690 10/60 (17%)
modNP_001247401.1 RRM_SF 177..244 CDD:302621 15/69 (22%)
RRM_SF 260..327 CDD:240668 10/58 (17%)
RRM_SF 342..411 CDD:240668
RRM_SF 422..>465 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.