DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shep and CG5213

DIOPT Version :9

Sequence 1:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:198 Identity:59/198 - (29%)
Similarity:88/198 - (44%) Gaps:19/198 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 KTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGL-- 304
            ||||.:..|.|..|:.:|..:.:::|.|...|.|..:.|.....|||||:.....|..||.|:  
  Fly    40 KTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDG 104

  Fly   305 ---QGKGVQAQMAKQQEQDPT--NLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQMN-SKG 363
               :||.::...|:..|.:.|  :||:.|||.:..|..:..:.:.||.:|...:||.:..| |:|
  Fly   105 YETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRG 169

  Fly   364 VGFARMESREKCEQIIQMFNGNTIPGAKDPLLVKFAD-----------GGPKKKNLFKTPDPNAR 417
            |.|.:.|.....|......:...|.||..||.|||.:           |...|.....:|.|..|
  Fly   170 VAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSGSQYKDKRKSSPPPYKR 234

  Fly   418 AWR 420
            ..|
  Fly   235 RER 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 23/74 (31%)
RRM2_MSSP 322..400 CDD:240690 27/80 (34%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 23/75 (31%)
RRM 128..202 CDD:214636 23/73 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.