Sequence 1: | NP_001246636.1 | Gene: | shep / 38605 | FlyBaseID: | FBgn0052423 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009298008.1 | Gene: | elavl3 / 30732 | ZFINID: | ZDB-GENE-980526-76 | Length: | 366 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 73/207 - (35%) |
---|---|---|---|
Similarity: | 113/207 - (54%) | Gaps: | 13/207 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 208 TLSTSLSNTTNTNTNMGPNGTVQNQNQQGGEQLSKTNLYIRGLQQGTTDKDLVNMCAQYGTIIST 272
Fly 273 KAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGKGVQAQMAKQQEQDPT-------NLYIANLP 330
Fly 331 PHFKETDLEAMLSKYGQVVSTRILRDQQMN--SKGVGFARMESREKCEQIIQMFNGNTIPGAKDP 393
Fly 394 LLVKFADGGPKK 405 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
shep | NP_001246636.1 | RRM1_MSSP | 243..313 | CDD:240689 | 24/69 (35%) |
RRM2_MSSP | 322..400 | CDD:240690 | 32/86 (37%) | ||
elavl3 | XP_009298008.1 | ELAV_HUD_SF | 35..365 | CDD:273741 | 62/175 (35%) |
RRM1_Hu | 37..114 | CDD:241094 | 26/76 (34%) | ||
RRM_SF | 119..209 | CDD:302621 | 33/89 (37%) | ||
RRM3_HuC | 282..366 | CDD:241099 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D614259at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |