DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shep and elavl3

DIOPT Version :9

Sequence 1:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_009298008.1 Gene:elavl3 / 30732 ZFINID:ZDB-GENE-980526-76 Length:366 Species:Danio rerio


Alignment Length:207 Identity:73/207 - (35%)
Similarity:113/207 - (54%) Gaps:13/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 TLSTSLSNTTNTNTNMGPNGTVQNQNQQGGEQLSKTNLYIRGLQQGTTDKDLVNMCAQYGTIIST 272
            |:.|.:||.. :.|:: |||.|.:.|  |....|||||.:..|.|..|.::..::....|.|.|.
Zfish     7 TMETQVSNGP-SGTSL-PNGPVISTN--GATDDSKTNLIVNYLPQNMTQEEFKSLFGSIGEIESC 67

  Fly   273 KAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGKGVQAQMAKQQEQDPT-------NLYIANLP 330
            |.:.||.|.:..|||||::..|..|:.|:..|.|..:|.:..|.....|:       |||::.||
Zfish    68 KLVRDKITGQSLGYGFVNYVDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLP 132

  Fly   331 PHFKETDLEAMLSKYGQVVSTRILRDQQMN--SKGVGFARMESREKCEQIIQMFNGNTIPGAKDP 393
            ....:.|:|.:.|:||:::::|||.||...  |:||||.|.:.|.:.|:.|:..||....||.:|
Zfish   133 KTMSQKDMEQLFSQYGRIITSRILVDQVTAGISRGVGFIRFDKRNEAEEAIKGLNGQKPLGAAEP 197

  Fly   394 LLVKFADGGPKK 405
            :.||||:...:|
Zfish   198 ITVKFANNPSQK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 24/69 (35%)
RRM2_MSSP 322..400 CDD:240690 32/86 (37%)
elavl3XP_009298008.1 ELAV_HUD_SF 35..365 CDD:273741 62/175 (35%)
RRM1_Hu 37..114 CDD:241094 26/76 (34%)
RRM_SF 119..209 CDD:302621 33/89 (37%)
RRM3_HuC 282..366 CDD:241099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614259at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.