DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shep and Pabpc6

DIOPT Version :9

Sequence 1:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001099678.1 Gene:Pabpc6 / 292295 RGDID:1311201 Length:643 Species:Rattus norvegicus


Alignment Length:447 Identity:103/447 - (23%)
Similarity:164/447 - (36%) Gaps:127/447 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 NLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQG-- 306
            |::::.|.:....|.|.:..:.:|.|:|.|.:.|:  |..||||||.||....||.|::.:.|  
  Rat   100 NIFVKNLDRSIDSKTLYDTFSAFGNILSCKVVCDE--NGSKGYGFVHFETQEEAERAIEKMNGMF 162

  Fly   307 --------------KGVQAQMAKQQEQDPTNLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQ 357
                          :..||::..:.::. ||:||.||.....:..|:.:.|::|..:|.:::.|:
  Rat   163 LNDRKVFVGRFKSRRDRQAELGARAKEF-TNVYIKNLGEDMDDERLQDLFSRFGPALSVKVMTDE 226

  Fly   358 QMNSKGVGFARMESREKCEQIIQMFNGNTIPG-------------AKDPLLVKFADGGPKKKNLF 409
            ...|||.||...|..|...:.:...||..:.|             .:..|..||......|..:.
  Rat   227 SGKSKGFGFVSFERHEDARKAVDEMNGKDLNGKQIYVGRAQKKVERQTELKHKFGQMKQDKPKIE 291

  Fly   410 KTPDPNARAWRDVSAEGIPV----------------AYDP--TMQQNGVSVNVGTPIGVPYSRFS 456
            :.|..     |.|..:|:.:                .:.|  |:....|::..|...|..:..||
  Rat   292 QVPQD-----RSVRCQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVTMEGGRSKGFGFVCFS 351

  Fly   457 AP--------QVGGYPVAGSQWIPGYMMTQVDDQTSYSPQYMQMAAAPPLGVTSYKPE-AVNQVQ 512
            :|        ::.|..||...........:.:.|...|.||||..|:     ||..|. .:|..|
  Rat   352 SPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLSNQYMQRMAS-----TSAVPNPGINPFQ 411

  Fly   513 P-RGISMMVSGDTGVPYGTMMPQLATLQIGNSYISP------------------TYPYYAPPPTI 558
            | :|:|           |..|...|..|...:|.:|                  .:|:......|
  Rat   412 PAQGLS-----------GYFMTATAPTQNRGTYYAPNQTTQQGPSARGSAQGTRAHPFQNMSSAI 465

  Fly   559 IP--TMPM------TDSE-------------------QASTAASP-DEAYTQYPHQA 587
            .|  |||.      |.|:                   .|||||:| ....|||.:.|
  Rat   466 HPSNTMPSFSTSGPTSSQAVRHRTASTSTQMMGPHPAAASTAAAPAARTVTQYKYTA 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 24/84 (29%)
RRM2_MSSP 322..400 CDD:240690 24/90 (27%)
Pabpc6NP_001099678.1 PABP-1234 11..622 CDD:130689 103/447 (23%)
RRM1_I_PABPs 12..91 CDD:240824
RRM2_I_PABPs 97..172 CDD:240825 22/73 (30%)
RRM3_I_PABPs 190..269 CDD:240826 21/79 (27%)
RRM4_I_PABPs 303..380 CDD:240827 12/76 (16%)
PABP 555..621 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.