DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shep and Elavl3

DIOPT Version :9

Sequence 1:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_758827.1 Gene:Elavl3 / 282824 RGDID:628892 Length:367 Species:Rattus norvegicus


Alignment Length:280 Identity:81/280 - (28%)
Similarity:130/280 - (46%) Gaps:52/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 PNGTVQNQNQQGGEQLSKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFV 289
            |||.:...|  |....|||||.:..|.|..|..:..::....|.|.|.|.:.||.|.:..|||||
  Rat    23 PNGPLLGTN--GATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFV 85

  Fly   290 DFEQPAFAECAVKGLQGKGVQAQMAKQQEQDPT-------NLYIANLPPHFKETDLEAMLSKYGQ 347
            ::..|..|:.|:..|.|..:|.:..|.....|:       |||::.||....:.::|.:.|:||:
  Rat    86 NYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGR 150

  Fly   348 VVSTRILRDQQMN-SKGVGFARMESREKCEQIIQMFNGNTIPGAKDPLLVKFADGGPKKK----- 406
            ::::|||.||... |:||||.|.:.|.:.|:.|:..||....||.:|:.||||: .|.:|     
  Rat   151 IITSRILLDQATGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFAN-NPSQKTGQAL 214

  Fly   407 --NLFKTPDPNARAWRDVSAEGIPVAYDPTMQQN---------GVSVNVGTPIGVPYSRFSAPQV 460
              :|:::   :||.:.           .|...|.         .::..|.:|:.: .:|||...:
  Rat   215 LTHLYQS---SARRYA-----------GPLHHQTQRFRLDNLLNMAYGVKSPLSL-IARFSPIAI 264

  Fly   461 GGYP----------VAGSQW 470
            .|..          .||:.|
  Rat   265 DGMSGLAGVGLSGGAAGAGW 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 24/69 (35%)
RRM2_MSSP 322..400 CDD:240690 31/85 (36%)
Elavl3NP_758827.1 ELAV_HUD_SF 36..366 CDD:273741 76/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614259at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.