DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shep and PABPC5

DIOPT Version :9

Sequence 1:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_543022.1 Gene:PABPC5 / 140886 HGNCID:13629 Length:382 Species:Homo sapiens


Alignment Length:174 Identity:45/174 - (25%)
Similarity:85/174 - (48%) Gaps:21/174 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 QGGEQLSKT---NLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAF 296
            |..::|.|:   |::|:.|.:...::.|..:.:.:|.|:|.|.:.|  .|..|||.:|.|:..|.
Human    95 QPDDRLRKSGVGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVVCD--DNGSKGYAYVHFDSLAA 157

  Fly   297 AECAVKGLQG-------------KGVQAQMAKQQEQDP---TNLYIANLPPHFKETDLEAMLSKY 345
            |..|:..:.|             |..:.:.|:.:.:|.   ||:::.|:.....:..|:.:..:|
Human   158 ANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTNVFVKNIGDDIDDEKLKELFCEY 222

  Fly   346 GQVVSTRILRDQQMNSKGVGFARMESREKCEQIIQMFNGNTIPG 389
            |...|.:::||....|||.||.|.|:.|..::.:...:|.:|.|
Human   223 GPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLHGKSIDG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 20/85 (24%)
RRM2_MSSP 322..400 CDD:240690 20/68 (29%)
PABPC5NP_543022.1 PABP-1234 22..>379 CDD:130689 45/174 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.