DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shep and PABPC4L

DIOPT Version :9

Sequence 1:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001108206.3 Gene:PABPC4L / 132430 HGNCID:31955 Length:370 Species:Homo sapiens


Alignment Length:261 Identity:62/261 - (23%)
Similarity:110/261 - (42%) Gaps:61/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 NLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGKG 308
            |::|:.|.:...:|.|....:.:|.|:|:|.:.|...:  |||.||.|:..:.|:.|::.:.||.
Human    99 NVFIKNLDKSIDNKTLYEHFSAFGKILSSKVMSDDQGS--KGYAFVHFQNQSAADRAIEEMNGKL 161

  Fly   309 V----------------QAQMAKQQEQDPTNLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQ 357
            :                :|:: :.:..:.||:||.|......:..|:.:.||||:.:|.:::.|.
Human   162 LKGCKVFVGRFKNRKDREAEL-RSKASEFTNVYIKNFGGDMDDERLKDVFSKYGKTLSVKVMTDS 225

  Fly   358 QMNSKGVGFARMESREKCEQIIQMFNGNTIPGAKDPLLVKFADGGPKK----------------- 405
            ...|||.||...:|.|..::.::..||..|.|.     :.|.....||                 
Human   226 SGKSKGFGFVSFDSHEAAKKAVEEMNGRDINGQ-----LIFVGRAQKKVERQAELKQMFEQLKRE 285

  Fly   406 ------------KNLFKTPDPNARAWRDVSAEGIPVAYDPTMQQNGVSVNVGTPIGVPYSRFSAP 458
                        |||..|.| :.:...:.|:.| .::....||:.|.|...|...      ||:|
Human   286 RIRGCQGVKLYIKNLDDTID-DEKLRNEFSSFG-SISRVKVMQEEGQSKGFGLIC------FSSP 342

  Fly   459 Q 459
            :
Human   343 E 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 21/84 (25%)
RRM2_MSSP 322..400 CDD:240690 24/77 (31%)
PABPC4LNP_001108206.3 RRM 10..>369 CDD:330708 62/261 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.