DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4603 and OTU2

DIOPT Version :9

Sequence 1:NP_001261435.1 Gene:CG4603 / 38603 FlyBaseID:FBgn0035593 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_011850.1 Gene:OTU2 / 856373 SGDID:S000001005 Length:307 Species:Saccharomyces cerevisiae


Alignment Length:314 Identity:75/314 - (23%)
Similarity:122/314 - (38%) Gaps:81/314 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGSFSVKLKSKKGQFIVN----DLNEHTTLGELKTKIVQATDIEATQLHVLVGYPPKPLDLSQQ 61
            :||......|||:.:  ||    ||.:     :||||  |..:|...::     ...:..|..|:
Yeast    31 ITGMKKQATKSKRKE--VNSKCLDLQD-----KLKTK--QENEIRDWKI-----ANNEVFDAEQE 81

  Fly    62 QE---QRALKAVGINSGETLIVEEKAAPAPAAPVPGGTTVE----DDEALARR----LQAEEEAQ 115
            .|   ::.|:.:.|:..     |::....|......|.|.:    ..|.||:|    .:.:|||.
Yeast    82 DEVTPEKLLEQLSISRD-----EKEQQNVPVQQQQQGQTKKRRNRQKERLAKRDAAIAKMKEEAA 141

  Fly   116 LLQETAGGP----VAQAADYQLPVAPTESGPNGDFNGILLKKV----VPADNSCLFTSIRFVLN- 171
            |  |.:..|    :.|.:..||               ..|||:    :..|..|||.||...|. 
Yeast   142 L--EASKQPDLKKMEQESIDQL---------------CELKKLKQFDIQPDGHCLFASILDQLKL 189

  Fly   172 ----GKVDNEGSEMMRHIIA----QEVAAD--PQSYNDAVLG-KSNAEYCAWIQKADSWGGAIEV 225
                .|:|.:...|....::    ||...|  |..:::..:. |...||...::....|||.||:
Yeast   190 RHDPKKLDQDMDVMKLRWLSCNYVQEHRDDFIPYLFDEETMKMKDIDEYTKEMEHTAQWGGEIEI 254

  Fly   226 SILSNYYGIEIDVV----DIQNAIINRFGEDKNFGLRVFLLFD---GIHYDPLY 272
            ..||:.:...|.::    .||  :.|..|::....| |:....   |.||:.|:
Yeast   255 LALSHVFDCPISILMSGRPIQ--VYNECGKNPELKL-VYYKHSYALGEHYNSLH 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4603NP_001261435.1 UBQ 5..80 CDD:214563 18/81 (22%)
UBQ 10..80 CDD:294102 18/76 (24%)
COG5539 <158..346 CDD:227826 35/134 (26%)
OTU2NP_011850.1 COG5539 1..306 CDD:227826 75/314 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.