DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4603 and AT1G50670

DIOPT Version :9

Sequence 1:NP_001261435.1 Gene:CG4603 / 38603 FlyBaseID:FBgn0035593 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001321194.1 Gene:AT1G50670 / 841489 AraportID:AT1G50670 Length:208 Species:Arabidopsis thaliana


Alignment Length:206 Identity:92/206 - (44%)
Similarity:133/206 - (64%) Gaps:9/206 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GILLKKVVPADNSCLFTSIRFVLNGKVDNEGSEMMRHIIAQEVAADPQSYNDAVLGKSNAEYCAW 212
            ||::::|:|:||||||.:|.:|:: |..|:..| :|.:||..||::.:.||:|.|||.|.|||||
plant     3 GIIVRRVIPSDNSCLFNAIGYVMD-KDKNKAPE-LRQVIAAAVASNKEKYNEAFLGKLNEEYCAW 65

  Fly   213 IQKADSWGGAIEVSILSNYYGIEIDVVDIQNAIINRFGEDKNFGLRVFLLFDGIHYDPLYM---E 274
            |...|.||||||:|||::|||.||...|||.:..:.:|:.:|:..||.|::||:|||.|.:   |
plant    66 ILNPDKWGGAIELSILADYYGREIAAYDIQTSRCDLYGQTRNYDERVMLIYDGLHYDALALSPFE 130

  Fly   275 TSPSAAPATIFPV---EELG-VYQQAEQLANEAQSSRQYTNVDKFTLRCMQCDVRLVGQVQAQEH 335
            .:......||:||   ..:| :...|..|..:.|..|.||:...|||||..|.:.::||.:|.||
plant   131 GAEEDFDMTIYPVGKDRSIGSIEGLALNLVKDQQRKRSYTDTANFTLRCGVCQIGVIGQKEAVEH 195

  Fly   336 AKQTGHKNFGE 346
            |:.|||.||.|
plant   196 AQATGHVNFQE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4603NP_001261435.1 UBQ 5..80 CDD:214563
UBQ 10..80 CDD:294102
COG5539 <158..346 CDD:227826 87/194 (45%)
AT1G50670NP_001321194.1 COG5539 <13..207 CDD:227826 88/196 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 94 1.000 Domainoid score I2531
eggNOG 1 0.900 - - E1_COG5539
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H13176
Inparanoid 1 1.050 175 1.000 Inparanoid score I1502
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1327072at2759
OrthoFinder 1 1.000 - - FOG0005589
OrthoInspector 1 1.000 - - oto3328
orthoMCL 1 0.900 - - OOG6_102949
Panther 1 1.100 - - LDO PTHR13312
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3996
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.