DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4603 and AT2G38025

DIOPT Version :9

Sequence 1:NP_001261435.1 Gene:CG4603 / 38603 FlyBaseID:FBgn0035593 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_850290.1 Gene:AT2G38025 / 818381 AraportID:AT2G38025 Length:234 Species:Arabidopsis thaliana


Alignment Length:211 Identity:47/211 - (22%)
Similarity:77/211 - (36%) Gaps:58/211 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ETAGGPVAQAAD----YQLP---VAPTESGP-------NGDFN-GILLKKV-------VPADNSC 161
            |....|.|..:|    ..||   ::.|:...       |...| ....|||       |..|..|
plant    23 ELVSSPTASVSDSISSTSLPASFISTTKGNSYVFFARINSSMNRSPAAKKVEKYAVDRVKGDGRC 87

  Fly   162 LFTSI--------RFVLNGKVDNEGSEMMRHIIAQEVAADP---QSYNDAVLG----KSNAEYCA 211
            ||.::        ...||.:.:.:.::.:|..:.:.:..||   :.|.:|::.    :|...:|.
plant    88 LFRALVKGMAFNKGITLNPQRERDDADELRMAVKEVICNDPKEREKYKEALVAITVDESLKRFCQ 152

  Fly   212 WIQKADSWGGAIEVSILSNY-------------------YGIE-IDVVDIQNAIINRFGEDKNFG 256
            .|.:.|.|||..|:.:||..                   ||.. |.:.:..:.....:|:.|...
plant   153 RIGRHDFWGGESELLVLSKLCKQPIIVYIPEHEHGRGGGYGPGFIPIQEYGSEFRGGWGKGKTNK 217

  Fly   257 LRVFLLFDG-IHYDPL 271
            ..|.||:.| .|||.|
plant   218 NVVRLLYSGRNHYDLL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4603NP_001261435.1 UBQ 5..80 CDD:214563
UBQ 10..80 CDD:294102
COG5539 <158..346 CDD:227826 34/150 (23%)
AT2G38025NP_850290.1 OTU 82..212 CDD:418725 24/129 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13312
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.