DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4603 and Otud6b

DIOPT Version :9

Sequence 1:NP_001261435.1 Gene:CG4603 / 38603 FlyBaseID:FBgn0035593 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_036020347.1 Gene:Otud6b / 72201 MGIID:1919451 Length:298 Species:Mus musculus


Alignment Length:297 Identity:59/297 - (19%)
Similarity:103/297 - (34%) Gaps:107/297 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLKSKKGQFIVNDLNEHTTLGE----LKTKIVQATDIEATQLHVLVGYPPKPLDLSQQQEQRALK 68
            |::..|.....||......|.|    |:.::.|....|..||..|.....|....:.::|:    
Mouse    60 KIQGMKNAVPKNDKKRRKQLTEDVAKLEREMEQKHREELEQLKQLTFKDSKEKKAALEKER---- 120

  Fly    69 AVGINSGETLIVEEKAAPAPAAPVPGGTTVEDDEALARRLQAEEEAQLLQETAGGPVAQAADYQL 133
                        ||:.|.|....:.|          ||.|::|:.||:|           |..:|
Mouse   121 ------------EERIAEAEIENLSG----------ARHLESEKLAQIL-----------AAREL 152

  Fly   134 PVAPTESGPNGDFNGILLKKVVPADNSCLFTSIRFVLNGKVDNEGSEMMRHIIAQEVAADPQSYN 198
            .:                 |.:|:|..|::.:    |..::..:...:....:.::.|...|:::
Mouse   153 EI-----------------KQIPSDGHCMYGA----LEDQLREQDCALTVASLRRQTAEYMQTHS 196

  Fly   199 DAVL-----------------GKSNAEYCAWIQKADSWGGAIEVSILSNYYGIEIDVV--DIQNA 244
            |..|                 ||    ||..|....:|||.:|:..||:.....|:::  |....
Mouse   197 DDFLPFLTNPSTGDMYTPEEFGK----YCDDIVNTAAWGGQLELRALSHILQTPIEILQADAPPI 257

  Fly   245 IINRFGED--KN----------FGLRVFLLFDGIHYD 269
            |:   ||:  :|          :||       |.||:
Mouse   258 IV---GEEYPRNPLVLVYMRHAYGL-------GEHYN 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4603NP_001261435.1 UBQ 5..80 CDD:214563 14/75 (19%)
UBQ 10..80 CDD:294102 13/73 (18%)
COG5539 <158..346 CDD:227826 29/143 (20%)
Otud6bXP_036020347.1 OTU 158..283 CDD:396767 28/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.