DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4603 and OTUD6B

DIOPT Version :9

Sequence 1:NP_001261435.1 Gene:CG4603 / 38603 FlyBaseID:FBgn0035593 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_057107.4 Gene:OTUD6B / 51633 HGNCID:24281 Length:293 Species:Homo sapiens


Alignment Length:306 Identity:63/306 - (20%)
Similarity:108/306 - (35%) Gaps:99/306 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLKSKKGQFIVNDLNEHTTLGE----LKTKIVQATDIEATQLH------------------VLVG 50
            |::..|.....||......|.|    |:.::.|....|..||.                  ||..
Human    29 KIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLEN 93

  Fly    51 YPPKPLDLSQQQEQRALKAVGINSGETLIVEEKAAPAPAAPVPGGTTVEDDEALARRLQAEEEAQ 115
            .||:   :|:.|::|..||......     ||:.|.|....:.|          ||.:::|:.||
Human    94 QPPR---ISKAQKRREKKAALEKER-----EERIAEAEIENLTG----------ARHMESEKLAQ 140

  Fly   116 LLQETAGGPVAQAADYQLPVAPTESGPNGDFNGILLKKVVPADNSCLFTSIRFVLNGK------- 173
            :|           |..||.:                 |.:|:|..|::.:|...|..|       
Human   141 IL-----------AARQLEI-----------------KQIPSDGHCMYKAIEDQLKEKDCALTVV 177

  Fly   174 -VDNEGSEMMRHIIAQ--EVAADPQSYNDAVLGKSNAEYCAWIQKADSWGGAIEVSILSNYYGIE 235
             :.::.:|.|:..:..  ....:|.: .|....:...:||..|....:|||.:|:..||:.....
Human   178 ALRSQTAEYMQSHVEDFLPFLTNPNT-GDMYTPEEFQKYCEDIVNTAAWGGQLELRALSHILQTP 241

  Fly   236 IDVVDIQNAIINRFGEDKN------------FGLRVFLLFDGIHYD 269
            |:::...:..| ..||:.:            :||       |.||:
Human   242 IEIIQADSPPI-IVGEEYSKKPLILVYMRHAYGL-------GEHYN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4603NP_001261435.1 UBQ 5..80 CDD:214563 20/93 (22%)
UBQ 10..80 CDD:294102 19/91 (21%)
COG5539 <158..346 CDD:227826 27/134 (20%)
OTUD6BNP_057107.4 COG5539 18..280 CDD:227826 63/306 (21%)
Cys-loop. /evidence=ECO:0000250 152..158 2/5 (40%)
OTU 153..278 CDD:280496 26/133 (20%)
Variable-loop. /evidence=ECO:0000250 219..229 4/9 (44%)
His-loop. /evidence=ECO:0000250 267..277 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.