DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4603 and Otud6a

DIOPT Version :9

Sequence 1:NP_001261435.1 Gene:CG4603 / 38603 FlyBaseID:FBgn0035593 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001156663.1 Gene:Otud6a / 408193 MGIID:3644685 Length:290 Species:Mus musculus


Alignment Length:273 Identity:61/273 - (22%)
Similarity:95/273 - (34%) Gaps:88/273 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DIEATQLHVLVGYPPKPLDLSQQQEQRALKAVGINSGETLIVEEKAAPAPAAPVPGGTTVEDDEA 103
            |:|...|.   ..||:|....:::::||.:...         .::..||..|           |.
Mouse    80 DLEKMNLE---NMPPRPPKAQKRRDRRAHQERR---------HQERMPAAQA-----------EQ 121

  Fly   104 LARRLQAEEEAQLLQETAGGPVAQAADYQLPVAPTESGPNGDFNGILLKKVVPADNSCLFTSIRF 168
            ||...:.|||                    .||......|      |..|.:|||..|::.:|:.
Mouse   122 LAANRREEEE--------------------KVAAILGAKN------LEMKTIPADGHCMYRAIQD 160

  Fly   169 VLNGKVDNEGSE------MMRHI------IAQEVAADPQSYNDAVLGKSNAEYCAWIQKADSWGG 221
            .|...|..|...      |.:||      ..:..|.:..:..|.:      .||..|....||||
Mouse   161 QLVFSVTIESLRYRTAYYMRKHIDDFLPFFTEPEAGNFYTREDFL------RYCDDIVHNASWGG 219

  Fly   222 AIEVSILSNYYGIEIDVVDIQNAIINRFGED---KNFGLRVFLLFD---GIHYDPLYMETSPSAA 280
            .:|:..||:.....|:||...:..| ..||:   |...| |:|.:.   |.||:           
Mouse   220 QLELRALSHVLQTPIEVVQANSPTI-VIGEEYTRKPVTL-VYLHYACDFGEHYN----------- 271

  Fly   281 PATIFPVEELGVY 293
              ::.|:|..|.:
Mouse   272 --SVKPIEVAGAF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4603NP_001261435.1 UBQ 5..80 CDD:214563 8/40 (20%)
UBQ 10..80 CDD:294102 8/40 (20%)
COG5539 <158..346 CDD:227826 37/154 (24%)
Otud6aNP_001156663.1 COG5539 5..272 CDD:227826 58/261 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..117 9/48 (19%)
Cys-loop. /evidence=ECO:0000250 147..153 3/5 (60%)
OTU 148..270 CDD:280496 34/129 (26%)
Variable-loop. /evidence=ECO:0000250 211..221 5/9 (56%)
His-loop. /evidence=ECO:0000250 259..269 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.