DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4603 and Otud6b

DIOPT Version :9

Sequence 1:NP_001261435.1 Gene:CG4603 / 38603 FlyBaseID:FBgn0035593 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_038965351.1 Gene:Otud6b / 297911 RGDID:1310024 Length:333 Species:Rattus norvegicus


Alignment Length:338 Identity:72/338 - (21%)
Similarity:119/338 - (35%) Gaps:126/338 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLKSKKGQFIVNDLNEHTTLGE----LKTKIVQATDIEATQLH------------------VLVG 50
            |::..|.....||......|.|    |:.::.|....|..||.                  ||..
  Rat    60 KIQGMKNAVPKNDKKRRKQLTEDVAKLEREMEQKHREELEQLKLTFKDSKIDSVAVNVSNLVLDS 124

  Fly    51 YPPKPLDLSQQQEQRALKAVGINSGETLIVEEKAAPAPAAPVPGGTTVEDDEALARRLQAEEEAQ 115
            .||:   :|:.|::|..||......     ||:.|.|....:.|          ||.|::|:.||
  Rat   125 QPPR---ISKAQKRREKKAALEKER-----EERIAEAEIENLSG----------ARHLESEKLAQ 171

  Fly   116 LLQETAGGPVAQAADYQLPVAPTESGPNGDFNGILLKKVVPADNSCLFTSIRFVLNGKVDNEGSE 180
            :|           |..:|.:                 |.:|:|..|::.:    |..::..:.|.
  Rat   172 IL-----------AARELEI-----------------KHIPSDGHCMYGA----LEDQLREQDSA 204

  Fly   181 MMRHIIAQEVAADPQSYNDAVL-----------------GKSNAEYCAWIQKADSWGGAIEVSIL 228
            :....:.::.|...||::|..|                 ||    ||..|....:|||.:|:..|
  Rat   205 LTVATLRRQTAEYMQSHSDDFLPFLTNPNTGDMYTPEEFGK----YCDDIVNTAAWGGQLELRAL 265

  Fly   229 SNYYGIEIDVV--DIQNAIINRFGED--KN----------FGLRVFLLFDGIHYDPL--YME--- 274
            |:.....|:::  |....|:   ||:  :|          :||       |.||:.:  |:.   
  Rat   266 SHILKTPIEILQADAPPIIV---GEEYPRNPLVLVYMRHAYGL-------GEHYNSVTRYLAFLI 320

  Fly   275 ----TSPSAAPAT 283
                .:|.|.|.|
  Rat   321 SNWWKTPKAGPVT 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4603NP_001261435.1 UBQ 5..80 CDD:214563 20/93 (22%)
UBQ 10..80 CDD:294102 19/91 (21%)
COG5539 <158..346 CDD:227826 36/166 (22%)
Otud6bXP_038965351.1 COG5539 43..311 CDD:227826 67/314 (21%)
OTU 184..309 CDD:396767 30/142 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.