DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4603 and otub-3

DIOPT Version :9

Sequence 1:NP_001261435.1 Gene:CG4603 / 38603 FlyBaseID:FBgn0035593 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001255319.1 Gene:otub-3 / 177679 WormBaseID:WBGene00009007 Length:330 Species:Caenorhabditis elegans


Alignment Length:251 Identity:56/251 - (22%)
Similarity:84/251 - (33%) Gaps:69/251 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EEKAAPA---------PAAPVPGGT--------------TVEDDEALARRLQAEEE-------AQ 115
            |.:|.||         |.:|.|.|:              ||:.....|::...:::       |:
 Worm    94 ESEAVPAENPEASTLSPPSPNPEGSDNDGEGPSSSAFYKTVKISNKAAKKQDKKKKTADKMKAAE 158

  Fly   116 LLQETAGGPVAQAADYQLPVAPTESGPNGDFNGILLKKV-VPADNSCLFTSIRFVLN-------- 171
            ...:.||  ..|.:|.|:..|..:.....|.    :|.: :|||..|::.:|...|.        
 Worm   159 AADKEAG--KNQLSDRQMEKAAVKEMLAEDH----MKMIDIPADGDCMYNAISHQLQEEGIEISV 217

  Fly   172 -------GKVDNEGSEMMRHIIAQEVAADPQSYNDAVLGKSNAEYCAWIQKADS----WGGAIEV 225
                   |....|.||..|..|......|..|        |.|.|...::....    |||.:|:
 Worm   218 RKLRKRCGTYMREHSEDFRPFIEDMANMDSDS--------SWATYLGGVENVAEIGGVWGGELEL 274

  Fly   226 SILSNYYGIEIDVVDIQNAIINRFGED----KNFGLRVFLLFDGIHYDPLYMETSP 277
            ...|..:...| ||..|....:..||:    |:..|||..|.........|..|.|
 Worm   275 KACSMIFEKTI-VVYKQYGGRHTIGEEYSSPKDRALRVVFLRHAYSLGEHYNSTCP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4603NP_001261435.1 UBQ 5..80 CDD:214563
UBQ 10..80 CDD:294102
COG5539 <158..346 CDD:227826 34/143 (24%)
otub-3NP_001255319.1 OTU 194..324 CDD:334900 33/138 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.