DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10674 and AT5G07960

DIOPT Version :9

Sequence 1:NP_647950.1 Gene:CG10674 / 38602 FlyBaseID:FBgn0035592 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_196413.1 Gene:AT5G07960 / 830690 AraportID:AT5G07960 Length:107 Species:Arabidopsis thaliana


Alignment Length:102 Identity:31/102 - (30%)
Similarity:48/102 - (47%) Gaps:17/102 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DPRR----KEKINRYKAPKNQGQSGGANEDMMPDYMNILGMIFSMCGLMMKLKWCAWFALYCSCI 66
            |||:    |..|.|..||          ||:..||...:.:|..:.|:|.:.|.|:|.|:.....
plant    13 DPRQPSAAKPYIPRPVAP----------EDLPVDYSGFIAVILGVSGVMFRYKICSWLAIIFCAQ 67

  Fly    67 SFASSR-ASDDAKQVLSSFMLSVSAVVMSYL--QNPA 100
            |.|:.| ..:|.||:..:.|.::..:|.:||  ..||
plant    68 SLANMRNLENDLKQISMAMMFAIMGLVTNYLGPNRPA 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10674NP_647950.1 UPF0139 4..103 CDD:397642 31/102 (30%)
AT5G07960NP_196413.1 UPF0139 10..105 CDD:397642 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4668
eggNOG 1 0.900 - - E1_KOG3462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2681
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1608233at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto4266
orthoMCL 1 0.900 - - OOG6_105079
Panther 1 1.100 - - LDO PTHR13193
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4866
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.