DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10674 and WDR83OS

DIOPT Version :9

Sequence 1:NP_647950.1 Gene:CG10674 / 38602 FlyBaseID:FBgn0035592 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_057229.1 Gene:WDR83OS / 51398 HGNCID:30203 Length:106 Species:Homo sapiens


Alignment Length:105 Identity:72/105 - (68%)
Similarity:86/105 - (81%) Gaps:3/105 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NMTVDPRRKEKINRYKAPKNQGQSGGANEDMMPDYMNILGMIFSMCGLMMKLKWCAWFALYCSCI 66
            ||: ||||..|:.|||.|.:  :...|.:|..|||||:|||||||||||:|||||||.|:|||.|
Human     5 NMS-DPRRPNKVLRYKPPPS--ECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAVYCSFI 66

  Fly    67 SFASSRASDDAKQVLSSFMLSVSAVVMSYLQNPAAMTPPW 106
            |||:||:|:|.||::||||||:|||||||||||..|||||
Human    67 SFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10674NP_647950.1 UPF0139 4..103 CDD:397642 65/98 (66%)
WDR83OSNP_057229.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 11/26 (42%)
UPF0139 5..103 CDD:397642 67/100 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 140 1.000 Domainoid score I4768
eggNOG 1 0.900 - - E1_KOG3462
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13954
Inparanoid 1 1.050 150 1.000 Inparanoid score I4385
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48893
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007506
OrthoInspector 1 1.000 - - oto91232
orthoMCL 1 0.900 - - OOG6_105079
Panther 1 1.100 - - LDO PTHR13193
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2412
SonicParanoid 1 1.000 - - X4866
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.