DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10674 and Wdr83os

DIOPT Version :9

Sequence 1:NP_647950.1 Gene:CG10674 / 38602 FlyBaseID:FBgn0035592 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001099417.1 Gene:Wdr83os / 288925 RGDID:1564058 Length:117 Species:Rattus norvegicus


Alignment Length:51 Identity:30/51 - (58%)
Similarity:37/51 - (72%) Gaps:3/51 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NMTVDPRRKEKINRYKAPKNQGQSGGANEDMMPDYMNILGMIFSMCGLMMK 52
            ||: ||||..|:.|||.|.:  :...|.:|..|||||:|||||||||||:|
  Rat     5 NMS-DPRRPNKVLRYKPPPS--ECNPALDDPTPDYMNLLGMIFSMCGLMLK 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10674NP_647950.1 UPF0139 4..103 CDD:397642 28/49 (57%)
Wdr83osNP_001099417.1 UPF0139 5..>52 CDD:281642 29/49 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352660
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1608233at2759
OrthoFinder 1 1.000 - - FOG0007506
OrthoInspector 1 1.000 - - oto98317
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13193
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4866
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.