DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10674 and K10B2.4

DIOPT Version :9

Sequence 1:NP_647950.1 Gene:CG10674 / 38602 FlyBaseID:FBgn0035592 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_495281.1 Gene:K10B2.4 / 174054 WormBaseID:WBGene00019607 Length:113 Species:Caenorhabditis elegans


Alignment Length:111 Identity:70/111 - (63%)
Similarity:88/111 - (79%) Gaps:5/111 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNMTVDPRRKEKINRYK---APKNQGQSGGANEDMMPDYMNILGMIFSMCGLMMKLKWCAWFALY 62
            |....||||..:|.|||   :..||.|:  .:||.:|:|||:|||||||||||:::|||:|.||.
 Worm     1 MQQNGDPRRTNRIVRYKPLDSTANQQQA--ISEDPLPEYMNVLGMIFSMCGLMIRMKWCSWLALV 63

  Fly    63 CSCISFASSRASDDAKQVLSSFMLSVSAVVMSYLQNPAAMTPPWAS 108
            |||||||::|.||||||::||||||||||||||||||:.:.|||.:
 Worm    64 CSCISFANTRTSDDAKQIVSSFMLSVSAVVMSYLQNPSPIIPPWVT 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10674NP_647950.1 UPF0139 4..103 CDD:397642 66/101 (65%)
K10B2.4NP_495281.1 UPF0139 3..104 CDD:281642 66/102 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166205
Domainoid 1 1.000 138 1.000 Domainoid score I3015
eggNOG 1 0.900 - - E1_KOG3462
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13954
Inparanoid 1 1.050 148 1.000 Inparanoid score I2992
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48893
OrthoDB 1 1.010 - - D1608233at2759
OrthoFinder 1 1.000 - - FOG0007506
OrthoInspector 1 1.000 - - oto18714
orthoMCL 1 0.900 - - OOG6_105079
Panther 1 1.100 - - LDO PTHR13193
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2412
SonicParanoid 1 1.000 - - X4866
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.