DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10674 and wdr83os

DIOPT Version :9

Sequence 1:NP_647950.1 Gene:CG10674 / 38602 FlyBaseID:FBgn0035592 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001119988.1 Gene:wdr83os / 100144944 XenbaseID:XB-GENE-1008772 Length:106 Species:Xenopus tropicalis


Alignment Length:101 Identity:70/101 - (69%)
Similarity:84/101 - (83%) Gaps:2/101 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DPRRKEKINRYKAPKNQGQSGGANEDMMPDYMNILGMIFSMCGLMMKLKWCAWFALYCSCISFAS 70
            ||||..|::|||||..  :|....:|..|||||:|||||||||||:|||||||.|:|||.||||:
 Frog     8 DPRRPGKVHRYKAPTT--ESSPTLDDPTPDYMNLLGMIFSMCGLMLKLKWCAWIAVYCSFISFAN 70

  Fly    71 SRASDDAKQVLSSFMLSVSAVVMSYLQNPAAMTPPW 106
            ||:|:|.||::||||||:|||||||||||..|:|||
 Frog    71 SRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMSPPW 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10674NP_647950.1 UPF0139 4..103 CDD:397642 66/96 (69%)
wdr83osNP_001119988.1 UPF0139 7..103 CDD:367605 66/96 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 141 1.000 Domainoid score I4701
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13954
Inparanoid 1 1.050 151 1.000 Inparanoid score I4256
OMA 1 1.010 - - QHG48893
OrthoDB 1 1.010 - - D1608233at2759
OrthoFinder 1 1.000 - - FOG0007506
OrthoInspector 1 1.000 - - oto105010
Panther 1 1.100 - - LDO PTHR13193
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2412
SonicParanoid 1 1.000 - - X4866
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.