DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4611 and AT1G71060

DIOPT Version :9

Sequence 1:NP_647949.1 Gene:CG4611 / 38601 FlyBaseID:FBgn0035591 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_177262.1 Gene:AT1G71060 / 843446 AraportID:AT1G71060 Length:510 Species:Arabidopsis thaliana


Alignment Length:344 Identity:71/344 - (20%)
Similarity:132/344 - (38%) Gaps:78/344 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QKFKPEKKPKEK--STKKVQDFGDPDTFGDAK-----VAATEDPGDVEEEEFLSNSTRRSKKLKA 147
            :::...:|.||.  :..|:::||......|..     ::.:.:.||.:         :...|:|.
plant   170 RRYARARKVKEAIGAFHKMEEFGFKMESSDFNRMLDTLSKSRNVGDAQ---------KVFDKMKK 225

  Fly   148 VEYARQIKDH----------LKANRLNEAIAVLEQRMLKEDRAKPDKYIYNLLISGCAKAGYTRK 202
            ..:...||.:          |...|::|.     .|.:|::..:||...|.::|:...||....:
plant   226 KRFEPDIKSYTILLEGWGQELNLLRVDEV-----NREMKDEGFEPDVVAYGIIINAHCKAKKYEE 285

  Fly   203 AFFLYTKMRQRGLQVTGGTYTSLFNACANAPSVSDGLAKAQILRENMLEKGYEPNVKNYNAMIKA 267
            |...:.:|.||..:.:...:.||.|...:...::|.|.    ..|.....|:......|||::.|
plant   286 AIRFFNEMEQRNCKPSPHIFCSLINGLGSEKKLNDALE----FFERSKSSGFPLEAPTYNALVGA 346

  Fly   268 YGRCGDVDTAYMLADEMMERQLELNADTFNFLL------------------QACA---------- 304
            |.....::.||...|||..:.:..||.|::.:|                  .:|.          
plant   347 YCWSQRMEDAYKTVDEMRLKGVGPNARTYDIILHHLIRMQRSKEAYEVYQTMSCEPTVSTYEIMV 411

  Fly   305 ---SNSEHGFRHALLTWHNMLQRGISPDYYSFNAMLRCARDCGFGDLDS----MREVID-KIAPS 361
               .|.|. ...|:..|..|..:|:.|..:.|::::...  |....||.    ..|::| .|.|.
plant   412 RMFCNKER-LDMAIKIWDEMKGKGVLPGMHMFSSLITAL--CHENKLDEACEYFNEMLDVGIRPP 473

  Fly   362 A---ARKKPVLQLEKGQQD 377
            .   :|.|..| |::|::|
plant   474 GHMFSRLKQTL-LDEGRKD 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4611NP_647949.1 PPR_2 <157..196 CDD:289786 9/48 (19%)
PPR_2 182..231 CDD:289786 13/48 (27%)
PPR 185..215 CDD:279828 8/29 (28%)
PPR repeat 186..213 CDD:276811 6/26 (23%)
PPR repeat 219..252 CDD:276811 6/32 (19%)
PPR_1 252..284 CDD:289614 9/31 (29%)
PPR_2 256..304 CDD:289786 14/65 (22%)
PPR repeat 258..287 CDD:276811 10/28 (36%)
PPR repeat 293..324 CDD:276811 9/61 (15%)
PPR repeat 330..357 CDD:276811 6/31 (19%)
PPR repeat 485..514 CDD:276811
PPR repeat 552..576 CDD:276811
AT1G71060NP_177262.1 PPR repeat 128..191 CDD:276811 4/20 (20%)
PPR_2 200..241 CDD:289786 6/49 (12%)
PPR repeat 200..226 CDD:276811 4/34 (12%)
PPR_2 230..279 CDD:289786 11/53 (21%)
PPR repeat 234..261 CDD:276811 5/31 (16%)
PPR_1 261..294 CDD:289614 7/32 (22%)
PPR_2 265..312 CDD:289786 13/46 (28%)
PPR repeat 267..296 CDD:276811 6/28 (21%)
PPR repeat 302..331 CDD:276811 6/32 (19%)
PPR repeat 337..366 CDD:276811 10/28 (36%)
PPR_2 339..382 CDD:289786 14/42 (33%)
PPR 339..372 CDD:273253 10/32 (31%)
PPR_2 370..416 CDD:289786 5/45 (11%)
PPR_1 400..431 CDD:289614 5/31 (16%)
PPR_2 402..451 CDD:289786 8/51 (16%)
PPR repeat 404..433 CDD:276811 5/29 (17%)
PPR repeat 439..467 CDD:276811 5/29 (17%)
PPR 440..472 CDD:273253 7/33 (21%)
PPR repeat 474..500 CDD:276811 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.