DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4611 and AT1G63330

DIOPT Version :9

Sequence 1:NP_647949.1 Gene:CG4611 / 38601 FlyBaseID:FBgn0035591 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_001322078.1 Gene:AT1G63330 / 842639 AraportID:AT1G63330 Length:559 Species:Arabidopsis thaliana


Alignment Length:471 Identity:112/471 - (23%)
Similarity:197/471 - (41%) Gaps:89/471 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 NRLNEAIAVLEQRMLKEDRAKPDKYIYNLLISGCAKAGYTRKAFFLYTKMRQRGLQVTGGTYTSL 225
            |:.:||:|::: ||::.. .:|:...|.::::|..|.|....||.|..||....::.....:.::
plant   129 NKASEAVALVD-RMVQRG-CQPNLVTYGVVVNGLCKRGDIDLAFNLLNKMEAAKIEADVVIFNTI 191

  Fly   226 FNACANAPSVSDGLAKAQILRENMLEKGYEPNVKNYNAMIK---AYGRCGDVDTAYMLADEMMER 287
            .::......|.|.|.    |.:.|..||..|||..|:::|.   :|||..|   |..|..:|:|:
plant   192 IDSLCKYRHVDDALN----LFKEMETKGIRPNVVTYSSLISCLCSYGRWSD---ASQLLSDMIEK 249

  Fly   288 QLELNADTFNFLLQACASNSEHGFRHALLTWHNMLQRGISPDYYSFNAMLR--CARDCGFGDLDS 350
            ::..|..|||.|:.|..  .|..|..|.....:|::|.|.||.:::|:::.  |..|    .||.
plant   250 KINPNLVTFNALIDAFV--KEGKFVEAEKLHDDMIKRSIDPDIFTYNSLINGFCMHD----RLDK 308

  Fly   351 MREVIDKIAPSAARKKPVLQLEKGQQDDLPSVEANTTTLPA-----QIEVATTASELELPNLLLP 410
            .:::.:.:.               .:|..|.::...|.:..     ::|..|        .|...
plant   309 AKQMFEFMV---------------SKDCFPDLDTYNTLIKGFCKSKRVEDGT--------ELFRE 350

  Fly   411 QPHLGSLVALEEVTRPHERFLLLGGL---------TGFLEHMKQHNITPDIETFTAMLEVIPPTN 466
            ..|.| ||. :.||..    .|:.||         ....:.|....:.|||.|::.:|:.:....
plant   351 MSHRG-LVG-DTVTYT----TLIQGLFHDGDCDNAQKVFKQMVSDGVPPDIMTYSILLDGLCNNG 409

  Fly   467 AAEKQLLTF--VRKIGLKADIDFFNILIKKRSMRFDYESAKEVLLMIRTAGLRPDIVTYGVLALG 529
            ..||.|..|  ::|..:|.||..:..:|:........:...::...:...|::|::|||..:..|
plant   410 KLEKALEVFDYMQKSEIKLDIYIYTTMIEGMCKAGKVDDGWDLFCSLSLKGVKPNVVTYNTMISG 474

  Fly   530 -C--RTQEEARELLEQMHVAGIKMNMPILGAMLRQGCANKSFSYVNEIIQLSLEEGLKPNEA-FL 590
             |  |..:||..||::|...|   .:|..|.             .|.:|:..|.:|.|...| .:
plant   475 LCSKRLLQEAYALLKKMKEDG---PLPDSGT-------------YNTLIRAHLRDGDKAASAELI 523

  Fly   591 RHLHNFHRGCARAIDA 606
            |.:    |.|....||
plant   524 REM----RSCRFVGDA 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4611NP_647949.1 PPR_2 <157..196 CDD:289786 9/34 (26%)
PPR_2 182..231 CDD:289786 10/48 (21%)
PPR 185..215 CDD:279828 9/29 (31%)
PPR repeat 186..213 CDD:276811 9/26 (35%)
PPR repeat 219..252 CDD:276811 5/32 (16%)
PPR_1 252..284 CDD:289614 13/34 (38%)
PPR_2 256..304 CDD:289786 19/50 (38%)
PPR repeat 258..287 CDD:276811 10/31 (32%)
PPR repeat 293..324 CDD:276811 9/30 (30%)
PPR repeat 330..357 CDD:276811 5/28 (18%)
PPR repeat 485..514 CDD:276811 2/28 (7%)
PPR repeat 552..576 CDD:276811 3/23 (13%)
AT1G63330NP_001322078.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2129
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.