DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4611 and PPR336

DIOPT Version :9

Sequence 1:NP_647949.1 Gene:CG4611 / 38601 FlyBaseID:FBgn0035591 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_564786.1 Gene:PPR336 / 842484 AraportID:AT1G61870 Length:408 Species:Arabidopsis thaliana


Alignment Length:282 Identity:65/282 - (23%)
Similarity:117/282 - (41%) Gaps:56/282 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 IDKIAPSA-----ARKK---PVLQLEKGQQDDLPSVE-----ANTTTLPAQ-------------- 392
            ||:||.||     |.||   .|..|..|..::.|.::     |:...|.||              
plant    78 IDRIAFSAAVENLAEKKHFSAVSNLLDGFIENRPDLKSERFAAHAIVLYAQANMLDHSLRVFRDL 142

  Fly   393 --IEVATTASELELPNLLLPQPHLGSLVA--LEEVTRPHERFLLLGGLTGFLEHMKQHNITPDIE 453
              .|::.|...|   |.||    ...|||  .:|..|.            ::|..|.:.|.||:|
plant   143 EKFEISRTVKSL---NALL----FACLVAKDYKEAKRV------------YIEMPKMYGIEPDLE 188

  Fly   454 TFTAMLEVIPPTNAAEK--QLLTFVRKIGLKADIDFFNILIKKRSMRFDYESAKEVLLMIRTAGL 516
            |:..|::|...:.:|..  .::..:.:.|:|.:...|.::|.........:...:||.|::..|:
plant   189 TYNRMIKVFCESGSASSSYSIVAEMERKGIKPNSSSFGLMISGFYAEDKSDEVGKVLAMMKDRGV 253

  Fly   517 RPDIVTYGV-LALGCRTQ--EEARELLEQMHVAGIKMNMPILGAMLRQGCANKSFSYVNEIIQLS 578
            ...:.||.: :...|:.:  :||:.||:.|..||:|.|......::...|....|....::.::.
plant   254 NIGVSTYNIRIQSLCKRKKSKEAKALLDGMLSAGMKPNTVTYSHLIHGFCNEDDFEEAKKLFKIM 318

  Fly   579 LEEGLKP-NEAFLRHLHNFHRG 599
            :..|.|| :|.:...::...:|
plant   319 VNRGCKPDSECYFTLIYYLCKG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4611NP_647949.1 PPR_2 <157..196 CDD:289786
PPR_2 182..231 CDD:289786
PPR 185..215 CDD:279828
PPR repeat 186..213 CDD:276811
PPR repeat 219..252 CDD:276811
PPR_1 252..284 CDD:289614
PPR_2 256..304 CDD:289786
PPR repeat 258..287 CDD:276811
PPR repeat 293..324 CDD:276811
PPR repeat 330..357 CDD:276811 1/1 (100%)
PPR repeat 485..514 CDD:276811 5/28 (18%)
PPR repeat 552..576 CDD:276811 2/23 (9%)
PPR336NP_564786.1 PPR repeat 123..145 CDD:276811 3/21 (14%)
PLN03218 <127..>349 CDD:215636 50/233 (21%)
PPR repeat 153..180 CDD:276811 10/45 (22%)
PPR repeat 187..216 CDD:276811 5/28 (18%)
PPR repeat 224..251 CDD:276811 5/26 (19%)
PPR repeat 259..286 CDD:276811 8/26 (31%)
PPR_2 290..339 CDD:372443 7/48 (15%)
PPR repeat 292..321 CDD:276811 2/28 (7%)
PPR repeat 327..356 CDD:276811 2/14 (14%)
PPR repeat 362..391 CDD:276811
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.