DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4611 and AT1G48700

DIOPT Version :10

Sequence 1:NP_647949.1 Gene:CG4611 / 38601 FlyBaseID:FBgn0035591 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_001321690.1 Gene:AT1G48700 / 841292 AraportID:AT1G48700 Length:316 Species:Arabidopsis thaliana


Alignment Length:100 Identity:24/100 - (24%)
Similarity:36/100 - (36%) Gaps:36/100 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CHIRGLQLNATGRRLNSYNISRLVILPATWSCSQNRLLHVRITDQQAGLETKREANRNQNPF--- 73
            ||:.|.:..|:|||.|       :||   | | ||.|.              ||....:..|   
plant   242 CHVHGARATASGRRAN-------MIL---W-C-QNSLF--------------REMQTYEPEFSDW 280

  Fly    74 -------REEVFEELITAAPKEHQKFKPEKKPKEK 101
                   .:|...:::....||..:.:.|.:|..|
plant   281 CGQCVHEEKENKSQILAVKRKEMFRIESEAEPPRK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4611NP_647949.1 PLN03218 <166..>561 CDD:215636
PPR repeat 186..213 CDD:276811
PPR repeat 219..252 CDD:276811
PPR repeat 258..287 CDD:276811
PPR repeat 293..324 CDD:276811
PPR repeat 330..357 CDD:276811
PPR repeat 485..514 CDD:276811
PPR repeat 552..576 CDD:276811
AT1G48700NP_001321690.1 P4Hc 93..263 CDD:214780 12/32 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.