DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4611 and AT1G09820

DIOPT Version :9

Sequence 1:NP_647949.1 Gene:CG4611 / 38601 FlyBaseID:FBgn0035591 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_172453.1 Gene:AT1G09820 / 837514 AraportID:AT1G09820 Length:606 Species:Arabidopsis thaliana


Alignment Length:447 Identity:93/447 - (20%)
Similarity:182/447 - (40%) Gaps:88/447 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 LKANRLNEAIAVLEQRMLKEDRAKPDKYIYNLLISGCAKAGYTRKAFFLYTKMRQRGLQVTGGTY 222
            ||.||..:...|.::.:.:  :.:|:.:.:|::|:...|.|...||..:...|:..|......:|
plant   199 LKENRSADVEYVYKEMIRR--KIQPNVFTFNVVINALCKTGKMNKARDVMEDMKVYGCSPNVVSY 261

  Fly   223 TSLFNACANAPSVSDGLAKAQILRENMLEKGYEPNVKNYNAMIKAYGRCGDVDTAYMLADEMMER 287
            .:|.:....... :..:.||..:.:.|:|....||:..:|.:|..:.:..::..:..:..||:::
plant   262 NTLIDGYCKLGG-NGKMYKADAVLKEMVENDVSPNLTTFNILIDGFWKDDNLPGSMKVFKEMLDQ 325

  Fly   288 QLELNADTFNFLLQACASNSEHGFRHALLTWHNMLQRGISPDYYSFNAMLRCARDCGFGDLDSMR 352
            .::.|..::|.|:....:..:  ...|:.....|:..|:.|:..::||::.     ||...|.::
plant   326 DVKPNVISYNSLINGLCNGGK--ISEAISMRDKMVSAGVQPNLITYNALIN-----GFCKNDMLK 383

  Fly   353 EVIDKIAPSAARKKPVLQLEKGQQDDLPSVEANTTTLPAQIEVATTASELELPNLLLPQPHLGSL 417
            |.:|...                            ::..|..|.||    .:.|:|:        
plant   384 EALDMFG----------------------------SVKGQGAVPTT----RMYNMLI-------- 408

  Fly   418 VALEEVTRPHERFLLLGGL-TGFL--EHMKQHNITPDIETFTAMLEVIPPTN--AAEKQLLTFVR 477
                      :.:..||.: .||.  |.|::..|.||:.|:..::..:....  .|.|:|...:.
plant   409 ----------DAYCKLGKIDDGFALKEEMEREGIVPDVGTYNCLIAGLCRNGNIEAAKKLFDQLT 463

  Fly   478 KIGLKADIDFFNILIKKRSMRFDYESAKEVLLMIRTAGLRPDIVTYGVLALG-C----------- 530
            ..|| .|:..|:||::....:.:...|..:|..:...||:|..:||.::..| |           
plant   464 SKGL-PDLVTFHILMEGYCRKGESRKAAMLLKEMSKMGLKPRHLTYNIVMKGYCKEGNLKAATNM 527

  Fly   531 RTQEEARELLEQMHVAGIKMNMPILGAMLRQGCANK-SFSYVNEIIQLSLEEGLKPN 586
            |||.|....| :|:||...        :|.||.:.| .....|.::...||:||.||
plant   528 RTQMEKERRL-RMNVASYN--------VLLQGYSQKGKLEDANMLLNEMLEKGLVPN 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4611NP_647949.1 PPR_2 <157..196 CDD:289786 8/37 (22%)
PPR_2 182..231 CDD:289786 11/48 (23%)
PPR 185..215 CDD:279828 7/29 (24%)
PPR repeat 186..213 CDD:276811 7/26 (27%)
PPR repeat 219..252 CDD:276811 5/32 (16%)
PPR_1 252..284 CDD:289614 4/31 (13%)
PPR_2 256..304 CDD:289786 9/47 (19%)
PPR repeat 258..287 CDD:276811 4/28 (14%)
PPR repeat 293..324 CDD:276811 4/30 (13%)
PPR repeat 330..357 CDD:276811 6/26 (23%)
PPR repeat 485..514 CDD:276811 5/28 (18%)
PPR repeat 552..576 CDD:276811 5/24 (21%)
AT1G09820NP_172453.1 PPR repeat 159..182 CDD:276811
PPR repeat 190..217 CDD:276811 5/17 (29%)
PPR_2 194..235 CDD:372443 8/37 (22%)
PLN03218 <221..>579 CDD:215636 88/423 (21%)
PPR repeat 225..252 CDD:276811 7/26 (27%)
PPR repeat 258..290 CDD:276811 5/32 (16%)
PPR repeat 296..324 CDD:276811 4/27 (15%)
PPR repeat 333..360 CDD:276811 4/28 (14%)
PPR repeat 368..395 CDD:276811 7/59 (12%)
PPR repeat 401..430 CDD:276811 9/50 (18%)
PPR repeat 436..465 CDD:276811 4/28 (14%)
PPR repeat 470..499 CDD:276811 5/28 (18%)
PPR repeat 505..534 CDD:276811 8/28 (29%)
PPR repeat 541..570 CDD:276811 8/36 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54853
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.