DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4611 and AT4G26800

DIOPT Version :9

Sequence 1:NP_647949.1 Gene:CG4611 / 38601 FlyBaseID:FBgn0035591 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_001329166.1 Gene:AT4G26800 / 828787 AraportID:AT4G26800 Length:514 Species:Arabidopsis thaliana


Alignment Length:399 Identity:83/399 - (20%)
Similarity:151/399 - (37%) Gaps:79/399 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 ANRLNEAIAVLEQRMLKEDRAKPDKYIYNLLISGCAKAGYTRKAFFLYTKMRQRGLQVTGGTYTS 224
            :|.:.:|:.|..|  :::...|.|..:..:||....|......|..:..:|:.||:.....||:|
plant   171 SNSIKDAVYVAGQ--MEKMGIKRDVVVDTILIDTLCKNRLVVPALEVLKRMKDRGISPNVVTYSS 233

  Fly   225 LFNACANAPSVSDGLAKAQILRENMLEKGYEPNVKNYNAMIKAY---GRCGDVDTAYMLADEMME 286
            |......    |..||.|:.....|..|...|||..::|:|.||   |:...||:.|.:   |::
plant   234 LITGLCK----SGRLADAERRLHEMDSKKINPNVITFSALIDAYAKRGKLSKVDSVYKM---MIQ 291

  Fly   287 RQLELNADTFNFLLQA-CASNSEHGFRHALLTWHNMLQRGISPDYYSFNAMLRCARDCGFGDLDS 350
            ..::.|..|::.|:.. |..|.   ...|:.....|:.:|.:|:..:::.:..     ||.....
plant   292 MSIDPNVFTYSSLIYGLCMHNR---VDEAIKMLDLMISKGCTPNVVTYSTLAN-----GFFKSSR 348

  Fly   351 MREVIDKIAPSAARKKPVLQLEKGQQDDLP--SVEANTTTLPAQIEVATTASELELPNLLLPQPH 413
            :.:.|..:                  ||:|  .|.|||.:....|:....|.:::|         
plant   349 VDDGIKLL------------------DDMPQRGVAANTVSCNTLIKGYFQAGKIDL--------- 386

  Fly   414 LGSLVALEEVTRPHERFLLLGGLTGFLEHMKQHNITPDIETFTAMLEVIPPTNAAEKQLLTFVRK 478
                 ||                 |...:|..:.:.|:|.::..:|..:......||.|..|...
plant   387 -----AL-----------------GVFGYMTSNGLIPNIRSYNIVLAGLFANGEVEKALSRFEHM 429

  Fly   479 IGLKADIDF--FNILIKKRSMRFDYESAKEVLLMIRTAGLRPDIVTYGVL-----ALGCRTQEEA 536
            ...:.|:|.  :.|:|.........:.|.::...::...:.||...|.::     ..|.||:.:|
plant   430 QKTRNDLDIITYTIMIHGMCKACMVKEAYDLFYKLKFKRVEPDFKAYTIMIAELNRAGMRTEADA 494

  Fly   537 RELLEQMHV 545
            .....|.||
plant   495 LNRFYQKHV 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4611NP_647949.1 PPR_2 <157..196 CDD:289786 8/35 (23%)
PPR_2 182..231 CDD:289786 12/48 (25%)
PPR 185..215 CDD:279828 6/29 (21%)
PPR repeat 186..213 CDD:276811 5/26 (19%)
PPR repeat 219..252 CDD:276811 9/32 (28%)
PPR_1 252..284 CDD:289614 12/34 (35%)
PPR_2 256..304 CDD:289786 15/51 (29%)
PPR repeat 258..287 CDD:276811 10/31 (32%)
PPR repeat 293..324 CDD:276811 6/31 (19%)
PPR repeat 330..357 CDD:276811 3/26 (12%)
PPR repeat 485..514 CDD:276811 4/30 (13%)
PPR repeat 552..576 CDD:276811
AT4G26800NP_001329166.1 PPR_2 83..135 CDD:404055
PPR repeat 88..114 CDD:276811
PLN03077 <116..>492 CDD:215561 79/386 (20%)
PPR repeat 123..152 CDD:276811
PPR repeat 160..187 CDD:276811 4/17 (24%)
PPR repeat 195..222 CDD:276811 5/26 (19%)
PPR repeat 230..257 CDD:276811 9/30 (30%)
PPR repeat 263..292 CDD:276811 10/31 (32%)
PPR repeat 298..327 CDD:276811 6/31 (19%)
PPR repeat 333..362 CDD:276811 6/51 (12%)
PPR repeat 368..397 CDD:276811 8/59 (14%)
PPR repeat 403..431 CDD:276811 6/27 (22%)
PPR repeat 438..465 CDD:276811 3/26 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.