Sequence 1: | NP_647949.1 | Gene: | CG4611 / 38601 | FlyBaseID: | FBgn0035591 | Length: | 703 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_178657.1 | Gene: | AT2G06000 / 815153 | AraportID: | AT2G06000 | Length: | 536 | Species: | Arabidopsis thaliana |
Alignment Length: | 365 | Identity: | 83/365 - (22%) |
---|---|---|---|
Similarity: | 140/365 - (38%) | Gaps: | 86/365 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 EHQKFKPEKKPKE------------KSTKKVQDFGDPDTFG---DAKVAATEDPGDVEEEEFLSN 137
Fly 138 STRRSKKLKA--------VEYARQIKDHLKANRLNEAIAVLEQRM-------------------- 174
Fly 175 ------LKEDRAK-------PDKYIYNLLISGCAKAGYTRKAFFLYTKMRQRGLQVTGGTYTSLF 226
Fly 227 NACANAPSVSDGLAKAQILRENMLEKGYEPNVKNYNAMIKAYGRCGDVDTAYMLADEMMERQLEL 291
Fly 292 NADTFNFLLQA-CASNSEHGFRHALLTWHNMLQRGISPDYYSFNAMLRCARDCGFGDLDSMREV- 354
Fly 355 -IDKIAPSAARKKPVLQLEKGQQDDLPSVEANT--TTLPA 391 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4611 | NP_647949.1 | PPR_2 | <157..196 | CDD:289786 | 13/71 (18%) |
PPR_2 | 182..231 | CDD:289786 | 16/48 (33%) | ||
PPR | 185..215 | CDD:279828 | 8/29 (28%) | ||
PPR repeat | 186..213 | CDD:276811 | 7/26 (27%) | ||
PPR repeat | 219..252 | CDD:276811 | 10/32 (31%) | ||
PPR_1 | 252..284 | CDD:289614 | 8/31 (26%) | ||
PPR_2 | 256..304 | CDD:289786 | 12/48 (25%) | ||
PPR repeat | 258..287 | CDD:276811 | 8/28 (29%) | ||
PPR repeat | 293..324 | CDD:276811 | 7/31 (23%) | ||
PPR repeat | 330..357 | CDD:276811 | 4/28 (14%) | ||
PPR repeat | 485..514 | CDD:276811 | |||
PPR repeat | 552..576 | CDD:276811 | |||
AT2G06000 | NP_178657.1 | PPR | 105..134 | CDD:279828 | |
PPR repeat | 105..132 | CDD:276811 | |||
PPR repeat | 175..200 | CDD:276811 | 2/3 (67%) | ||
PPR_2 | 205..253 | CDD:289786 | 9/47 (19%) | ||
PPR | 208..241 | CDD:273253 | 5/32 (16%) | ||
PPR repeat | 208..235 | CDD:276811 | 3/26 (12%) | ||
PPR_1 | 236..266 | CDD:289614 | 6/30 (20%) | ||
PPR_2 | 239..289 | CDD:289786 | 10/50 (20%) | ||
PPR repeat | 241..270 | CDD:276811 | 6/29 (21%) | ||
PPR_1 | 273..303 | CDD:289614 | 8/29 (28%) | ||
PPR_2 | 275..324 | CDD:289786 | 8/48 (17%) | ||
PPR repeat | 279..306 | CDD:276811 | 7/26 (27%) | ||
PPR repeat | 312..341 | CDD:276811 | 3/28 (11%) | ||
PPR | 313..347 | CDD:273253 | 4/33 (12%) | ||
PPR_1 | 342..373 | CDD:289614 | 8/30 (27%) | ||
PPR_2 | 345..394 | CDD:289786 | 16/48 (33%) | ||
PPR repeat | 347..373 | CDD:276811 | 6/25 (24%) | ||
PPR_1 | 376..407 | CDD:289614 | 12/34 (35%) | ||
PPR repeat | 382..411 | CDD:276811 | 10/32 (31%) | ||
PPR repeat | 417..446 | CDD:276811 | 8/28 (29%) | ||
PPR | 418..451 | CDD:273253 | 8/32 (25%) | ||
PPR_2 | 420..463 | CDD:289786 | 11/42 (26%) | ||
PPR_1 | 446..479 | CDD:289614 | 6/35 (17%) | ||
PPR_2 | 450..499 | CDD:289786 | 13/51 (25%) | ||
PPR repeat | 452..479 | CDD:276811 | 6/29 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |