DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prpk and STE11

DIOPT Version :9

Sequence 1:NP_647948.1 Gene:Prpk / 38600 FlyBaseID:FBgn0035590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_013466.1 Gene:STE11 / 851076 SGDID:S000004354 Length:717 Species:Saccharomyces cerevisiae


Alignment Length:199 Identity:40/199 - (20%)
Similarity:69/199 - (34%) Gaps:71/199 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GAEGRLYLG--DFKGEACLIKERFVKK---------------------------------YRHPE 38
            |:.|.:|||  ...||...:|:..:|.                                 ..||:
Yeast   424 GSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPK 488

  Fly    39 LNTQITRQRMKAEAKASGRCLAAGILAPKILHSDLNTH----------KLYMEYFDAAKTAKQF- 92
            .|..|.|:.:.|......       |..::.|.::.|:          .:::||......:... 
Yeast   489 TNQNIHRKMVDALQHEMN-------LLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLN 546

  Fly    93 ----IQETVSTQTEDEAKKCLLEFCTRIGEIIGKMHSNHIIHGDLTTSNILINPKGGDYDVILID 153
                .:|::.|           .|..:|...:..:|..:|||.|:..:||||:.||   .|.:.|
Yeast   547 NYGPFEESLIT-----------NFTRQILIGVAYLHKKNIIHRDIKGANILIDIKG---CVKITD 597

  Fly   154 FGLS 157
            ||:|
Yeast   598 FGIS 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrpkNP_647948.1 PKc_like 3..224 CDD:304357 40/199 (20%)
STE11NP_013466.1 SAM_Ste11_fungal 20..82 CDD:188933
Ras_bdg_2 121..224 CDD:405528
PKc_like 415..712 CDD:419665 40/199 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.