DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcs5 and AT1G08120

DIOPT Version :10

Sequence 1:NP_647948.1 Gene:Tcs5 / 38600 FlyBaseID:FBgn0035590 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_172292.4 Gene:AT1G08120 / 837331 AraportID:AT1G08120 Length:87 Species:Arabidopsis thaliana


Alignment Length:52 Identity:24/52 - (46%)
Similarity:35/52 - (67%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLEILKQGAEGRLYLGDFKGEACLIKERFVKKYRHPELNTQITRQRMKAEAK 53
            ||.::|||||.|:....|.|...::||||.||||||.|:.::|.:|:..:.|
plant    15 SLVLIKQGAEARVLESTFSGRRSIVKERFSKKYRHPILDAKLTLKRLYDKGK 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcs5NP_647948.1 Protein Kinases, catalytic domain 5..218 CDD:473864 22/49 (45%)
AT1G08120NP_172292.4 Protein Kinases, catalytic domain 18..>60 CDD:473864 20/41 (49%)

Return to query results.
Submit another query.